SecReT6
Protein ID: 471316104
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1598
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1536312..1536797 [-]
ProductVC_A0107 family type VI secretion protein
NoteTssB
UniProt IDI7GTP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-54, Aligned region: 5..157
Protein Sequence: 161 a.a.     [Download]
>gi|471316104|ref|YP_007601459.1| VC_A0107 family type VI secretion protein [Helicobacter cinaedi ATCC BAA-847]
MSDGSSAPKERINITYKAKTNGQEADVELPLKLMVMTNLTGGADKLPLEEREILQINKVNFSQVMQKLDI
SSKFSVKNTLGTGAEELSINLKISSMKDFSPDSIAKQIPELNKLMQLREALVALKGPMGNIPDFRKAVLT
ALKDKKTKEKLLLEIKEEVKE
 
Nucleotide Sequence: 486 bp     [Download]
>gi|471314537|ref|NC_020555.1|:c1536797-1536312 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGTCTGATGGTTCTAGTGCTCCAAAAGAGCGTATTAATATCACATACAAAGCAAAAACGAATGGACAAG
AAGCAGATGTTGAGTTACCCTTAAAATTGATGGTAATGACAAATTTGACAGGAGGAGCTGATAAATTACC
TTTGGAAGAGCGAGAGATTTTACAAATTAATAAGGTAAATTTTAGTCAGGTAATGCAGAAATTGGATATT
AGTTCTAAATTTAGTGTTAAGAACACCTTGGGCACAGGAGCAGAAGAGCTAAGTATTAATCTTAAAATTT
CTAGTATGAAAGACTTTTCCCCAGATAGTATAGCAAAGCAAATTCCCGAGCTTAATAAACTTATGCAACT
AAGAGAGGCTTTAGTGGCTTTAAAAGGACCTATGGGTAATATTCCAGATTTTAGAAAAGCAGTTTTAACC
GCTTTAAAAGATAAAAAAACAAAAGAGAAATTGCTTTTAGAAATTAAAGAAGAAGTCAAAGAATAG