SecReT6
Protein ID: 471316106
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1600
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1538267..1538722 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDI7H5K5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-17, Aligned region: 19..147
Protein Sequence: 151 a.a.     [Download]
>gi|471316106|ref|YP_007601461.1| type VI secretion lipoprotein [Helicobacter cinaedi ATCC BAA-847]
MYQKILILALCLLFGACSNNVSVKISNIEKSNLNNRFDDVPVTLIIYKLKDVKKFEEANDKDLITREDGA
LGKDKIDSIKLQIAPKSEIVAIKVKDKEVPYIGLLALFASDTKKVTKAWVKTKDASGLWSRFWNEKTLKF
EITQEGIKTIK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|471314537|ref|NC_020555.1|:1538267-1538722 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGTATCAAAAAATACTAATTTTGGCTTTATGTCTTTTATTTGGAGCTTGCTCAAACAATGTGAGTGTAA
AAATAAGTAACATTGAAAAATCAAATCTTAATAATAGATTTGATGATGTTCCTGTTACTCTTATTATCTA
TAAACTTAAGGATGTTAAAAAATTTGAAGAAGCAAATGATAAGGACTTAATTACTAGAGAAGATGGAGCT
CTTGGTAAGGATAAAATAGATTCAATCAAATTACAAATTGCTCCTAAAAGCGAAATTGTAGCAATAAAAG
TTAAGGATAAAGAAGTTCCCTACATTGGTCTTTTAGCTTTATTTGCCAGTGATACAAAAAAAGTAACTAA
AGCTTGGGTTAAAACAAAAGATGCAAGCGGACTTTGGAGTAGATTTTGGAATGAAAAAACACTAAAATTT
GAAATCACACAAGAAGGAATTAAAACGATTAAATGA