SecReT6
Protein ID: 471316107
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1601
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1538739..1540139 [+]
ProductVC_A0114 family type VI secretion protein
NoteTssK
UniProt IDI7GZD0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-114, Aligned region: 19..465
Protein Sequence: 466 a.a.     [Download]
>gi|471316107|ref|YP_007601462.1| VC_A0114 family type VI secretion protein [Helicobacter cinaedi ATCC BAA-847]
MANQLKVAWFNGLNIDKIHFEQQERYFQRNIDLKTIEVSNNLYGIIDLKFSNELLIQGKIALEKISGIAK
DGSIFNAPEQDLLPEALEINYESLENSVIVLKIPLSTASIADVALQNNFPNSKYLTLRSIIASRTYDDNH
SVGISRELLEDEKDLQNTTFTQEKINLTLASLRLKLGILGNATPDELEIPIAKIKNIDSNKKIELEENFI
PTCININKVSIVKSFLEETLYSIKQHKEMLWEVFKGIDQTKNTLDFSTYLSLNLLKKWFLIFSYLIHKNK
LHPEYLYEKLIEFQGELGAFGVENSFLEFIAYQHDNLNETFFPLINNIKILFAKITSPRYSMAKLIDNGN
GFYDLLFDNAGILEESELFLAINADVNHEYLLKNFKTQSKIHTQSKIKNIVATQLRGLNIIQIPNIPSAI
PYLNGYVYYKLDKKDELFKHFKGENAISIYLTHNIKNPDIKMWAVF
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|471314537|ref|NC_020555.1|:1538739-1540139 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGGCAAATCAACTAAAAGTTGCTTGGTTTAATGGTTTAAATATTGATAAAATTCATTTTGAACAGCAAG
AGAGATATTTTCAAAGAAATATAGATTTAAAAACCATTGAAGTATCAAATAATCTTTATGGAATTATTGA
TTTAAAATTTTCTAATGAACTGCTTATACAAGGTAAGATTGCATTAGAAAAAATTTCTGGGATAGCTAAA
GATGGAAGTATTTTTAACGCTCCAGAACAAGATTTATTGCCAGAAGCTTTAGAAATCAATTATGAATCAT
TAGAAAATTCGGTTATAGTATTAAAAATCCCTCTAAGCACTGCTAGCATTGCTGATGTAGCCCTACAAAA
TAATTTTCCTAATTCTAAATACCTAACTTTAAGAAGCATTATTGCCTCAAGAACTTATGATGATAACCAT
AGTGTAGGTATTTCAAGGGAATTATTAGAAGATGAAAAAGATTTACAAAATACAACTTTTACTCAGGAAA
AAATTAACTTAACGCTTGCGAGTTTGAGACTGAAACTCGGAATTTTAGGCAATGCAACACCTGATGAACT
TGAGATTCCTATTGCCAAAATTAAAAATATAGATTCAAATAAAAAAATAGAGCTTGAAGAAAATTTTATT
CCTACCTGTATTAATATCAACAAAGTTTCCATTGTCAAGTCTTTTTTAGAAGAAACATTATATTCTATCA
AACAACATAAAGAGATGCTTTGGGAAGTTTTTAAAGGCATTGACCAAACAAAAAATACTTTAGATTTCAG
CACTTATTTATCTTTAAATCTTCTTAAAAAATGGTTTTTAATTTTTTCTTACCTTATTCACAAGAACAAA
TTACACCCCGAATATTTATATGAAAAGCTTATTGAATTTCAGGGGGAACTTGGGGCATTTGGCGTTGAAA
ATTCCTTTTTAGAATTTATTGCCTACCAACACGATAATTTAAATGAAACTTTTTTTCCTTTAATCAATAA
TATAAAGATTTTATTTGCTAAAATTACTTCTCCGAGATATTCAATGGCAAAACTTATAGATAATGGTAAT
GGTTTCTATGATTTGTTATTTGATAACGCTGGAATTTTAGAAGAATCTGAACTTTTCTTAGCCATTAATG
CTGATGTTAATCACGAATATTTATTAAAAAACTTTAAAACACAAAGTAAAATCCATACGCAGAGTAAAAT
CAAAAATATAGTAGCTACTCAACTTAGAGGATTGAATATTATCCAAATTCCAAATATTCCTTCAGCTATC
CCTTATTTAAATGGCTATGTTTATTATAAGCTAGATAAAAAAGATGAATTGTTTAAACATTTTAAAGGAG
AAAACGCAATAAGTATTTACCTTACTCATAATATTAAGAATCCTGATATAAAAATGTGGGCAGTATTTTA
A