SecReT6
Protein ID: 471316108
SecReT6 ID737
T6SS typei1
Gene symbol-
Locus tagHCBAA847_1602
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1540149..1540916 [+]
Producttype IV / VI secretion system protein
NoteTssL
UniProt IDI7HDK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-40, Aligned region: 26..233
DUF624 [PF04854], Evalue: 0.0083, Aligned region: 177..232
Protein Sequence: 255 a.a.     [Download]
>gi|471316108|ref|YP_007601463.1| type IV / VI secretion system protein [Helicobacter cinaedi ATCC BAA-847]
MQKQSNAETQEFSLLLSSGLSGLGNNKVVDYCLELLLLSFRLSKVTLLDTSTIESLREKIVNDILTWSSK
LSALREYDEKDIIRLRYCLCVFIDEMLMKNELFINSSWANNTLTVRLFDETLGGDNFYDITHSWLNNPAK
NKDFLEFIYACLVLGYKGKYSNNKDVEERILLFCNNIASSLTPLYDVSEELAFTKAYDGIMKESFWQNFQ
RMYLKKILIALPLCIIVGVFIYAVFDLEVNNRRIHDSVNEIIKNY
 
Nucleotide Sequence: 768 bp     [Download]
>gi|471314537|ref|NC_020555.1|:1540149-1540916 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGCAAAAACAATCAAATGCAGAGACACAAGAATTTAGCTTGCTTTTAAGTTCCGGTTTAAGCGGTCTTG
GAAATAATAAAGTTGTTGATTATTGTTTAGAACTCCTCTTGCTCTCTTTTAGATTATCTAAAGTAACCTT
ACTTGATACAAGCACCATAGAATCCCTTAGAGAAAAAATTGTCAATGATATTTTGACTTGGAGTTCCAAA
CTTAGTGCTTTAAGAGAATATGATGAAAAAGACATTATTAGGCTTAGATATTGCCTTTGTGTTTTCATTG
ATGAGATGTTAATGAAAAATGAGCTTTTTATTAATAGCTCTTGGGCAAATAATACCCTAACAGTGCGTTT
ATTTGACGAAACTTTAGGGGGAGATAATTTTTATGATATAACACATTCTTGGCTTAACAATCCTGCCAAA
AACAAAGATTTTTTAGAATTTATTTATGCCTGTCTTGTATTGGGTTACAAAGGCAAATATTCAAACAACA
AAGATGTAGAAGAAAGAATTTTGCTTTTTTGTAATAATATTGCTTCTTCTCTCACACCATTATATGATGT
TAGTGAAGAACTAGCCTTTACAAAAGCTTATGATGGAATCATGAAGGAGAGTTTTTGGCAAAATTTTCAA
AGAATGTATCTTAAAAAAATTTTAATTGCTTTGCCTTTATGTATCATTGTAGGAGTTTTTATCTATGCTG
TATTTGACCTTGAAGTTAATAACAGACGAATACACGATAGCGTGAATGAAATTATCAAAAATTATTAA