SecReT6
Protein ID: 472323938
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03810
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]821031..823070 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDM4WSD5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.70E-73, Aligned region: 29..327
Phage_base_V [PF04717], Evalue: 3.60E-24, Aligned region: 376..468
DUF2345 [PF10106], Evalue: 0.0003, Aligned region: 579..620
Protein Sequence: 679 a.a.     [Download]
>gi|472323938|ref|YP_007656184.1| Rhs element Vgr protein [Pseudomonas denitrificans ATCC 13867]
MFNPANQTHFSLSIEGVDSDLQVLEFRGSEGISRPYRFEVELVSERFDLKLDELLHKRAFLAFAPGGAGI
HGQIHRVAQGDAGKRLCRYHVVLVPQLAYLAHRTNQRIFQQLTVPEIIASVLEEHGIQADAYQFSLGPTV
YPKRDYCTQYDESDLHFIQRLCEEEGIHYHFRHGSDGHRLVFGDDQTAFPRLGQPTPYIPDTGMVADLPV
IKRFNLGLEARTSRVTRRDYDFQKPRLLMEAAFKPQAATAEPDLEDYDYPGRFTDRERGKHLSQRTLERH
RADYRTARGEGDQPKLVSGHFLELSEHPRGEWNDLWLLVEVIHQGKQPQVLEESVTSDVTDDKDDFHQGY
RNRFVATPWDVPYRPALEHPKPKVLGNQSAVVTGPAGEEIHCDPYGRVKVQFFWDREGQANDKTSCWLRV
ASGWAGNAFGGVAIPRVGMEVLVSFLEGDPDQPLVSGCLYHAENQVPYPLPANKTRSLFKTNSYPGGGGY
NELRIEDRKGQEQIFIHAQRDWDENIEHDQRIRIGHERHDTVEANTYSEFKAEEHRTTHGDRKVETRIDD
HLTVANNQHIKVGTGQFIDAGQEIHLKAGQKLVVEAGMEITLKAGGSFIKLDPGGVTLVGAMVKVNAGGS
PGNGSGIGIKAPLQPNAADADKTGKEMEEALINAPLERPEPKTFFLFSE
 
Nucleotide Sequence: 2040 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c823070-821031 Pseudomonas denitrificans ATCC 13867, complete genome
ATGTTCAACCCCGCCAACCAGACCCACTTCAGCCTCAGCATCGAAGGGGTCGACAGCGACCTGCAGGTCC
TCGAGTTCCGTGGCAGCGAAGGCATCAGCCGGCCCTACCGGTTCGAGGTCGAGCTGGTCAGCGAGCGCTT
CGACCTGAAGCTCGACGAGCTGCTGCACAAGCGCGCCTTCCTGGCCTTCGCCCCTGGCGGCGCCGGTATC
CACGGGCAGATCCACCGCGTGGCCCAGGGCGATGCCGGTAAGCGTCTGTGCCGCTACCACGTGGTGCTGG
TGCCGCAACTGGCCTACCTCGCCCACCGCACCAACCAGCGCATCTTCCAACAGCTGACGGTGCCCGAGAT
CATCGCCAGCGTGCTCGAGGAGCACGGCATCCAGGCCGACGCTTACCAGTTCAGCCTCGGCCCCACCGTC
TACCCCAAGCGCGACTACTGCACCCAGTACGACGAGTCCGACCTGCACTTCATCCAGCGCCTGTGCGAAG
AGGAAGGCATCCACTACCACTTCCGCCACGGCAGCGACGGTCACCGTCTGGTGTTCGGCGACGACCAGAC
CGCTTTCCCGCGCCTGGGCCAGCCCACGCCCTACATCCCCGACACCGGCATGGTCGCCGACCTGCCGGTG
ATCAAGCGCTTCAACCTCGGCCTGGAAGCGCGCACCAGCCGCGTCACCCGCCGCGACTACGACTTCCAGA
AGCCGCGCCTGCTGATGGAAGCGGCCTTCAAACCGCAAGCCGCGACCGCCGAACCGGACCTGGAAGACTA
CGACTACCCCGGCCGCTTCACCGACCGCGAGCGCGGCAAGCACCTGAGCCAGCGCACCCTGGAACGCCAC
CGCGCCGACTACCGCACCGCCCGCGGCGAGGGCGACCAGCCGAAGCTCGTCAGCGGCCACTTCCTCGAAC
TCTCCGAGCACCCGCGCGGCGAGTGGAACGACCTCTGGCTGCTCGTCGAAGTCATCCACCAGGGCAAACA
GCCGCAAGTGCTGGAAGAGTCCGTCACCAGCGACGTCACCGACGACAAGGACGATTTCCATCAGGGCTAT
CGCAACCGCTTCGTAGCCACCCCCTGGGACGTGCCCTACCGCCCTGCGCTGGAGCACCCCAAACCCAAGG
TGCTGGGCAACCAGAGCGCCGTGGTCACCGGCCCTGCCGGGGAGGAAATCCACTGCGACCCGTACGGCCG
GGTGAAGGTGCAGTTCTTCTGGGACCGTGAGGGCCAGGCGAACGACAAGACCAGCTGCTGGCTGCGCGTC
GCCAGCGGCTGGGCCGGCAACGCCTTCGGCGGCGTCGCCATCCCGCGCGTGGGCATGGAGGTGCTGGTCA
GTTTCCTCGAGGGCGACCCCGACCAGCCGCTGGTCTCCGGCTGCCTCTACCACGCCGAGAACCAGGTGCC
CTACCCCCTGCCCGCGAACAAGACCCGCAGCCTGTTCAAGACCAACAGCTACCCCGGTGGCGGCGGTTAC
AACGAACTGCGCATCGAGGACCGCAAGGGCCAGGAACAGATCTTCATCCACGCCCAGCGCGATTGGGACG
AAAACATCGAGCACGACCAGCGCATCCGCATCGGCCACGAACGCCACGACACCGTCGAAGCCAACACCTA
CAGCGAATTCAAGGCCGAGGAACACCGCACCACCCACGGCGACCGCAAGGTGGAAACGCGCATCGACGAC
CACCTCACCGTGGCCAACAACCAGCACATCAAAGTCGGCACCGGCCAGTTCATCGACGCCGGCCAGGAAA
TCCACCTCAAGGCCGGGCAGAAACTGGTCGTCGAAGCCGGCATGGAAATCACCCTCAAGGCCGGCGGCAG
CTTCATCAAGCTCGACCCGGGCGGCGTCACCCTGGTCGGCGCGATGGTGAAGGTCAACGCCGGCGGCTCA
CCGGGCAACGGCTCGGGCATCGGCATCAAGGCGCCGCTGCAACCCAACGCGGCCGACGCGGACAAGACGG
GGAAAGAGATGGAAGAGGCGCTGATCAATGCGCCGCTGGAACGCCCCGAGCCGAAAACCTTCTTCCTGTT
CTCCGAATGA