SecReT6
Protein ID: 472323942
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03830
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]828377..829246 [-]
Productputative outer membrane protein
NoteTssL
UniProt IDM4WRE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-71, Aligned region: 61..266
Protein Sequence: 289 a.a.     [Download]
>gi|472323942|ref|YP_007656188.1| putative outer membrane protein [Pseudomonas denitrificans ATCC 13867]
MIKEMDYRQDDKTVLVDREGDSHSRSPLTDFAEPPRFEQLEARMIYAARLRPEETFNISLNPLVAAAAEL
LSEVVRLKHSNGGEDLHTLNHQLSTGIKQFELRALHEGAENSQVMAARYVLCTVLDEAVVTTDWGNESEW
SQMSLLSSFHNETFGGEKFFQLLERLSRNPVKHLPMLELMYLCLALGFEGKYRVLPRGMLELEAVRDSLY
RQIRQLRGDVPRELSPHWEGLRDSRRRLVRIVPWWLVALFTLVCLVVMYSGFAWVLDDQRESVLQPYQQL
DPAAVEPTS
 
Nucleotide Sequence: 870 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c829246-828377 Pseudomonas denitrificans ATCC 13867, complete genome
ATGATCAAGGAAATGGATTACCGGCAGGACGACAAGACCGTCCTGGTCGACCGCGAGGGCGACAGCCACT
CGCGCAGCCCACTCACCGACTTCGCCGAGCCGCCGCGTTTCGAACAGTTGGAAGCACGGATGATCTACGC
CGCGCGGCTGCGCCCGGAAGAGACCTTCAACATCAGTCTCAACCCGCTGGTGGCCGCCGCTGCCGAACTG
CTCTCGGAAGTGGTGCGGCTCAAGCACTCCAACGGTGGCGAGGACCTGCACACGCTCAACCACCAGTTGA
GCACCGGCATCAAGCAGTTCGAACTGCGCGCGCTGCACGAAGGCGCCGAGAACAGCCAGGTGATGGCGGC
CCGCTACGTGCTCTGCACCGTGCTCGACGAAGCGGTGGTGACCACCGACTGGGGCAACGAAAGCGAGTGG
TCGCAGATGAGCCTGCTCAGCAGCTTCCACAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGCTGCTGG
AGCGTCTGTCGCGCAATCCGGTGAAGCACCTGCCGATGTTGGAGCTGATGTACCTGTGCCTGGCCCTGGG
CTTCGAGGGCAAGTACCGCGTGTTGCCACGCGGCATGCTCGAGCTCGAAGCGGTGCGCGACAGCCTGTAC
CGGCAGATCCGCCAGTTGCGCGGCGACGTGCCCCGCGAGCTGTCGCCGCATTGGGAAGGCCTGCGTGACT
CGCGCCGGCGCCTGGTGCGCATCGTGCCCTGGTGGCTGGTGGCGCTCTTCACCCTGGTCTGCCTGGTGGT
GATGTATTCGGGCTTCGCCTGGGTACTCGATGACCAGCGCGAAAGCGTCCTGCAACCCTATCAGCAGCTC
GACCCGGCGGCGGTCGAGCCCACGTCGTAA