SecReT6
Protein ID: 472323943
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03835
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]829251..830582 [-]
Producthypothetical protein
NoteTssK
UniProt IDM4WSE0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-146, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|472323943|ref|YP_007656189.1| hypothetical protein H681_03835 [Pseudomonas denitrificans ATCC 13867]
MIAHKVIWREGMLLRPQHFQQNDRYHDHQLKSRTRLLGRYAWGFFGLEIDSQFLATGKLVLSRASGVLPD
GTLFDLASRDEPLALDIPPNTSNTPVYLALPLVTGNHIEARRPEQIDVLARYTTRDQEVADSNAGDSASS
QVTCGHADFRLLLGEQRNDQAYVRLKVCDVLDTSPDGRITLDPDFIPSHLHFHESGYLLSCLKEVISMLG
HRGDTLAERIRSTGKVGGAEVGDFMMLQLINRTELVLRHNLDLEQVHPEEVYRTLLAMLGDLATFSSETK
RPRLDGRYQHSDQGASFRKLMEAIRQVLSMVLEQHAIELVLQQRQYGILVSPLHDHKLLGNSSFVLAASA
QCESEELRQRLPAHLKAGPVERIRQLVNLHLPGIRVKPLPVAPRQIPFHANKTYFILELNPEEQAQLERS
GGFAFHVSGEFAGLELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c830582-829251 Pseudomonas denitrificans ATCC 13867, complete genome
ATGATCGCGCACAAAGTCATCTGGCGTGAGGGCATGCTCCTGCGCCCGCAGCACTTTCAGCAGAACGACC
GCTACCACGACCACCAGCTCAAGTCCCGTACCCGCCTGCTCGGCCGTTACGCCTGGGGCTTCTTCGGCCT
GGAGATCGACAGCCAGTTCCTCGCCACCGGCAAGCTGGTGCTCAGCCGAGCCTCCGGCGTGCTGCCGGAC
GGCACCCTGTTCGACCTCGCCAGTCGCGATGAACCACTGGCCCTGGACATCCCGCCGAACACCAGCAACA
CCCCGGTCTACCTGGCCTTGCCGCTGGTCACCGGCAACCACATCGAGGCCCGCCGCCCCGAGCAGATCGA
CGTGCTGGCACGCTACACCACCCGCGACCAGGAAGTGGCCGACTCCAACGCCGGCGACAGCGCCAGCAGC
CAGGTCACCTGCGGCCACGCCGACTTCCGCCTGTTGCTGGGCGAGCAACGCAACGATCAGGCCTACGTAC
GCCTGAAGGTCTGCGACGTACTCGATACCTCGCCGGACGGACGCATCACTCTCGACCCGGACTTCATTCC
CAGCCACCTGCACTTCCACGAGAGCGGCTACCTGCTGTCGTGCCTGAAGGAAGTGATCAGCATGCTCGGC
CACCGCGGCGACACCCTGGCCGAGCGCATTCGCTCCACCGGCAAGGTGGGCGGCGCCGAGGTCGGCGACT
TCATGATGCTGCAGCTGATCAACCGTACCGAGCTGGTGCTGCGCCACAACCTGGACCTGGAGCAGGTACA
CCCCGAAGAGGTGTACCGCACGCTGCTGGCGATGCTCGGCGACCTGGCCACCTTCTCCAGCGAAACCAAG
CGCCCGCGACTGGACGGCCGCTACCAGCACAGCGACCAGGGCGCCAGCTTCCGCAAGCTGATGGAAGCCA
TCCGTCAGGTGCTGTCGATGGTGCTCGAGCAGCACGCCATCGAGCTGGTCCTGCAGCAACGCCAGTACGG
CATCCTGGTCTCGCCGCTGCACGATCACAAGCTGCTCGGCAACTCCTCCTTCGTGCTCGCCGCCAGCGCC
CAGTGCGAGTCCGAGGAGCTGCGCCAGCGCCTGCCGGCGCACCTCAAGGCCGGTCCGGTGGAGCGCATCC
GCCAGCTGGTCAACCTGCACCTGCCGGGTATCCGCGTGAAGCCATTGCCGGTGGCTCCACGGCAGATCCC
GTTCCACGCCAACAAGACCTACTTCATCCTCGAACTCAACCCGGAAGAGCAGGCGCAACTGGAGCGATCC
GGCGGCTTCGCCTTCCATGTGTCCGGCGAATTCGCCGGGCTCGAACTGAAGTTCTGGGCTATCAGGAACT
GA