SecReT6
Protein ID: 472323944
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03840
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]830584..831069 [-]
Producthypothetical protein
NoteTssJ
UniProt IDM4XBC3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.70E-42, Aligned region: 14..149
Protein Sequence: 161 a.a.     [Download]
>gi|472323944|ref|YP_007656190.1| hypothetical protein H681_03840 [Pseudomonas denitrificans ATCC 13867]
MSALRSFALLALVLLTSACSVLSPYSKMTKLDLTLSASDQLNPDLDGRPSPIVVRLIELKNPVAFENADF
FSLYERSKESLAPDLVASEEIELRPGETRELKLTVQDGSRYVGVLAAYRDLPETRWRYVVALTPVQLNRA
DLRLDQTGIQTLADASPAKGE
 
Nucleotide Sequence: 486 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c831069-830584 Pseudomonas denitrificans ATCC 13867, complete genome
ATGTCAGCTCTCCGCTCCTTCGCCCTGCTCGCCCTGGTCCTGCTGACCAGCGCCTGCTCGGTGCTCTCGC
CCTACTCGAAGATGACCAAGCTGGACCTGACCCTGAGCGCCAGCGACCAGTTGAACCCGGACCTCGACGG
CCGTCCCTCGCCCATCGTGGTGCGCCTGATCGAACTGAAGAACCCGGTGGCCTTCGAGAACGCCGACTTC
TTCAGCCTCTACGAGCGCTCGAAGGAATCCCTGGCGCCGGACCTGGTCGCCAGCGAAGAGATCGAACTGC
GCCCCGGCGAGACCCGCGAGCTCAAGCTCACCGTCCAGGATGGCAGCCGCTACGTCGGCGTGCTGGCGGC
CTACCGCGACCTGCCGGAAACCCGCTGGCGCTACGTGGTGGCCCTGACCCCGGTACAGCTCAACCGCGCC
GACCTGCGCCTGGACCAGACCGGCATCCAGACCCTCGCCGACGCCAGCCCGGCCAAGGGGGAATGA