SecReT6
Protein ID: 472323945
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03845
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]831075..832271 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDM4WU06
KEGG IDpdr:H681_03845
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.80E-14, Aligned region: 29..97
FHA [PF00498], Evalue: 3.80E-14, Aligned region: 159..168
Protein Sequence: 398 a.a.     [Download]
>gi|472323945|ref|YP_007656191.1| FHA domain-containing protein [Pseudomonas denitrificans ATCC 13867]
MELVFEMVSAQQFVPGLLTSKTFKEAGGVIGRAEDCDWVIPDARRHLSNHHAQISYREGGFYLTDNSSNG
VQLKASGARLQKGLPQRIEHGAVYCLGDFEIRARLVQDPAIFGEEIGRPRAAGSIIPDDAFLDLDPLTAI
DQQERIYAQSEDYGMLGAQHADIRYQADYAPIDMESLPLPQLVEPPAQLADAPAAEVERQPDGFWQRFGE
QLGVNLDGLDQDAREALAIQAARLLRQCVGGLQQSLRTRTELKNELRLALTSVPGHSGNPLKSSADSREA
LNALLLGARPGQASAEQSISRTFRDLQAHQVALLSASRAAVRGTLEHFAPEQLALRFERDGQVSRLTGAA
GRWRAYGRYHHSLRQDDEWGERLLARDFAQAYEEQVRLIATLNSEPQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c832271-831075 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGAACTGGTATTCGAAATGGTGAGCGCCCAGCAGTTCGTGCCCGGCCTGCTGACCAGCAAGACCTTCA
AGGAGGCCGGTGGCGTGATCGGCCGCGCCGAGGACTGCGACTGGGTGATCCCCGATGCCCGCCGCCACCT
GTCCAACCACCACGCACAGATCAGCTATCGCGAAGGCGGGTTCTACCTGACCGACAACAGCAGCAACGGC
GTCCAGCTCAAGGCCAGCGGCGCGCGCCTGCAGAAGGGCCTGCCGCAGCGCATCGAGCATGGCGCGGTCT
ACTGCCTGGGTGACTTCGAGATCCGCGCGCGCCTGGTGCAGGACCCGGCCATCTTCGGTGAAGAAATCGG
CCGCCCACGCGCCGCCGGCAGCATCATTCCCGACGACGCCTTCCTCGACCTCGATCCGCTGACCGCCATC
GACCAGCAGGAGCGCATCTACGCCCAGAGCGAAGACTACGGGATGCTCGGTGCCCAGCACGCCGACATCC
GCTACCAGGCCGACTACGCGCCCATCGACATGGAAAGCCTGCCGCTGCCGCAACTGGTGGAACCGCCAGC
GCAGCTTGCCGACGCTCCTGCCGCCGAGGTGGAGCGCCAACCCGACGGCTTCTGGCAGCGCTTCGGCGAG
CAACTGGGTGTGAACCTCGATGGCCTCGACCAGGACGCCCGCGAAGCCCTGGCGATCCAGGCTGCACGAC
TGCTGCGCCAGTGCGTCGGCGGCCTGCAGCAGAGCCTGCGCACCCGCACCGAGCTGAAGAACGAACTGCG
CCTGGCGCTGACCAGCGTGCCAGGCCACAGCGGCAACCCGCTCAAATCCAGTGCCGACAGCCGCGAAGCG
CTGAACGCGCTGCTGCTTGGCGCACGGCCCGGCCAGGCAAGTGCCGAGCAGTCCATCTCGCGCACCTTCC
GTGACCTCCAGGCCCACCAGGTGGCGCTGCTCAGCGCCAGCCGCGCCGCAGTGCGCGGCACCCTCGAACA
CTTCGCTCCGGAGCAGCTGGCGTTGCGCTTCGAGCGCGACGGCCAGGTCTCCCGCCTCACCGGCGCAGCC
GGCCGCTGGCGCGCCTACGGGCGCTACCACCACTCCCTGCGCCAGGACGATGAATGGGGCGAGCGCCTGC
TCGCCCGCGATTTTGCCCAGGCCTACGAGGAACAGGTCCGGCTGATCGCCACCCTCAACAGCGAACCCCA
AGGATGA