SecReT6
Protein ID: 472323948
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03860
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]834016..836598 [-]
ProductClpB protein
NoteTssH
UniProt IDM4WSE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-44, Aligned region: 206..306
AAA_2 [PF07724], Evalue: 1.40E-44, Aligned region: 594..759
AAA [PF00004], Evalue: 1.50E-20, Aligned region: 208..339
AAA [PF00004], Evalue: 1.50E-20, Aligned region: 599..721
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 208..237
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 598..718
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 38..77
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 185..230
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 252..287
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 569..634
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 663..692
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 744..845
ClpB_D2-small [PF10431], Evalue: 7.60E-10, Aligned region: 429..452
ClpB_D2-small [PF10431], Evalue: 7.60E-10, Aligned region: 768..839
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 597..703
AAA_17 [PF13207], Evalue: 7.30E-08, Aligned region: 208..276
AAA_17 [PF13207], Evalue: 7.30E-08, Aligned region: 450..477
AAA_17 [PF13207], Evalue: 7.30E-08, Aligned region: 597..633
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 349..384
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 596..620
Sigma54_activat [PF00158], Evalue: 2.20E-05, Aligned region: 202..228
Sigma54_activat [PF00158], Evalue: 2.20E-05, Aligned region: 598..716
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 208..273
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 500..525
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 596..630
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 208..236
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 598..624
IstB_IS21 [PF01695], Evalue: 4.70E-05, Aligned region: 202..228
IstB_IS21 [PF01695], Evalue: 4.70E-05, Aligned region: 598..616
IstB_IS21 [PF01695], Evalue: 4.70E-05, Aligned region: 788..825
Clp_N [PF02861], Evalue: 0.00012, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.00012, Aligned region: 103..122
AAA_18 [PF13238], Evalue: 0.00031, Aligned region: 208..235
AAA_18 [PF13238], Evalue: 0.00031, Aligned region: 599..636
Arch_ATPase [PF01637], Evalue: 0.0004, Aligned region: 188..226
Arch_ATPase [PF01637], Evalue: 0.0004, Aligned region: 260..293
Arch_ATPase [PF01637], Evalue: 0.0004, Aligned region: 597..610
AAA_29 [PF13555], Evalue: 0.00078, Aligned region: 202..225
AAA_29 [PF13555], Evalue: 0.00078, Aligned region: 596..623
ResIII [PF04851], Evalue: 0.001, Aligned region: 190..230
ResIII [PF04851], Evalue: 0.001, Aligned region: 275..290
ResIII [PF04851], Evalue: 0.001, Aligned region: 570..626
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 208..247
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 256..288
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 597..633
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 177..235
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 597..610
SRP54 [PF00448], Evalue: 0.0067, Aligned region: 208..230
SRP54 [PF00448], Evalue: 0.0067, Aligned region: 597..619
Zeta_toxin [PF06414], Evalue: 0.0084, Aligned region: 207..229
Zeta_toxin [PF06414], Evalue: 0.0084, Aligned region: 597..638
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 209..229
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 599..619
Protein Sequence: 860 a.a.     [Download]
>gi|472323948|ref|YP_007656194.1| ClpB protein [Pseudomonas denitrificans ATCC 13867]
MINLDLQQLVQALDAETRRDLEGAAERCVARGGSKILVEDLLLALLERPQGLLQRALQDADVDAGELAAA
LVPRAESSASRNPVFAAELMQWLQDALLVANLELRESQIDQAALILALLRNPMRYAGSHYQPLLARLNAD
RLRDFALAQKPEDGNAPASGKGESMLERFTHNLTRQARDGKLDPVLCRDSAIRQMIDILARRRKNNPIVV
GEAGVGKTAVVEGLAARIATGEVPHALQGVELLSLDMGLLQAGASVKGEFERRLKGVIEEVKASAKPIIL
FIDEAHTLIGAGAQAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVGE
AVTILRGLAKVYEASHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLEKL
RGELAEGERQRQALRRDQEAGLSIDREALQALEARLEEAATQELELQQRWQQQRDLASELLDLRQQLAAA
RVDAERREQSAELEQRLHDVHASLRYAQEQERLVSFEVCPRLVSEVISHWTGVPLSQLAREHNAKVASFA
TDLRQRVRGQEQAVQALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETAIALADLLYGGERFLTTIN
MSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDEVEKADPDVLNLFYQIFDKGIANDGE
GREIDFRNTLILMTSNLASERISALCADGQRPDAEDLEEAIRPALSRHFKPALLARMRVVPYYPVSGDVL
RELVQLKLGRLGERMQRRQLGFSHCQALVEHLAERCTRSESGARLIDQLMDAHLLPQIADRLLDAMAAGE
TLRQVHATLDSDARPVCEFS
 
Nucleotide Sequence: 2583 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c836598-834016 Pseudomonas denitrificans ATCC 13867, complete genome
ATGATCAACCTCGACCTGCAACAACTCGTCCAGGCGCTGGACGCCGAAACCCGCCGCGACCTGGAAGGCG
CCGCCGAGCGCTGCGTCGCCCGTGGCGGCAGCAAGATCCTCGTCGAGGACCTCCTGCTGGCCCTGCTGGA
ACGCCCGCAAGGCCTGCTGCAGCGCGCCCTGCAGGACGCCGACGTCGACGCCGGCGAGCTGGCCGCCGCC
TTGGTGCCGCGCGCTGAAAGCAGCGCCTCGCGCAACCCGGTGTTCGCCGCCGAGCTGATGCAGTGGCTGC
AGGACGCCCTGCTGGTCGCCAATCTGGAACTGCGCGAAAGCCAGATCGACCAGGCCGCGCTGATCCTCGC
CCTGCTGCGCAACCCGATGCGCTATGCCGGCAGCCACTACCAGCCGCTGCTGGCACGCCTGAACGCGGAC
CGCCTGCGTGACTTCGCCCTGGCGCAGAAGCCTGAGGACGGCAACGCGCCGGCCAGCGGCAAGGGCGAGT
CGATGCTCGAACGCTTCACCCACAACCTCACGCGCCAGGCCCGCGACGGCAAGCTCGATCCGGTGCTGTG
CCGGGACAGCGCGATCCGCCAGATGATCGACATCCTCGCCCGCCGCCGGAAGAACAACCCGATCGTGGTC
GGCGAGGCCGGGGTCGGCAAGACGGCGGTGGTCGAAGGGCTGGCCGCGCGGATCGCTACCGGCGAAGTGC
CGCATGCCTTGCAAGGCGTCGAGCTGCTGTCGCTGGACATGGGCCTGCTGCAGGCCGGCGCCAGCGTGAA
AGGCGAATTCGAGCGCCGCCTCAAGGGCGTGATCGAGGAAGTGAAGGCGTCCGCCAAACCGATCATCCTG
TTCATCGACGAAGCCCACACGCTGATCGGCGCAGGCGCCCAGGCCGGTGGCTCGGATGCCGCCAACCTGC
TCAAGCCCGCGCTGGCGCGCGGCGAACTGCGCACCATCGCCGCCACCACCTGGGCGGAGTACAAGAAGTA
CTTCGAGAAGGACCCGGCGCTGGCCCGGCGCTTCCAGCCGGTGCAACTGCACGAGCCCACGGTCGGTGAG
GCAGTCACCATCCTGCGCGGGCTGGCGAAGGTCTACGAGGCCAGCCACGGCATCTACCTGCGCGACGACG
CGGTGGTCGCCGCCGCAGAACTGTCCGCCCGCTACCTCGCCGGCCGCCAATTGCCAGACAAAGCCGTCGA
CGTGCTCGATACCGCCTGCGCTCGCGTGCGCATCAGCCTGGCCGCCGCGCCGGAAAGCCTGGAGAAACTG
CGCGGCGAACTGGCCGAAGGCGAGCGCCAGCGCCAGGCGCTGCGCCGCGACCAGGAAGCAGGGCTGAGCA
TCGACCGGGAAGCACTGCAAGCACTGGAAGCCCGGCTCGAAGAAGCCGCCACCCAGGAGCTCGAATTGCA
GCAGCGCTGGCAGCAGCAGCGCGACCTCGCTAGCGAACTGCTCGATCTGCGCCAGCAACTGGCTGCCGCC
CGTGTCGACGCAGAGCGCCGGGAGCAAAGCGCTGAGCTCGAACAGCGCCTGCACGACGTGCATGCCTCGC
TGCGCTATGCGCAGGAACAGGAACGCCTGGTCAGCTTCGAAGTCTGCCCACGACTGGTTTCCGAAGTGAT
CAGCCACTGGACAGGCGTACCGCTGTCGCAACTGGCCCGCGAGCACAATGCCAAGGTCGCCAGCTTCGCC
ACCGACCTGCGCCAGCGTGTACGCGGCCAGGAGCAGGCGGTACAGGCGCTGGACCGCGCCATGCGCGCCA
CCGCTGCCGGCCTGAACAAGCCCGATGCGCCGGTGGGCGTGTTCCTGCTGGTCGGCCCCAGCGGCGTCGG
CAAGACCGAGACCGCCATCGCCCTGGCCGACCTGCTGTACGGCGGCGAGCGCTTCCTCACCACCATCAAC
ATGTCCGAGTTCCAGGAGAAGCACACCGTCTCGCGCCTGATCGGCGCTCCTCCGGGCTACGTCGGCTACG
GCGAGGGCGGCATGCTCACCGAGGCGGTGCGGCAGAAGCCCTACTCGGTGGTGCTGCTCGATGAGGTGGA
GAAGGCCGACCCGGACGTGCTCAACCTCTTCTACCAGATCTTCGACAAGGGCATCGCCAACGATGGCGAA
GGCCGCGAGATCGACTTCCGCAACACGCTGATCCTGATGACCTCCAACCTCGCCAGCGAGCGCATCTCCG
CACTCTGCGCCGACGGCCAGCGCCCGGACGCCGAGGACCTGGAAGAAGCCATCCGGCCGGCGCTCAGCCG
CCACTTCAAGCCAGCCCTGCTGGCGCGCATGCGCGTGGTGCCCTACTACCCGGTAAGCGGCGACGTGCTG
CGTGAGCTGGTGCAGCTCAAGCTCGGCCGCCTGGGCGAGCGCATGCAGCGCCGTCAGCTCGGCTTCAGCC
ACTGCCAGGCACTGGTCGAACACCTGGCCGAACGCTGCACCCGGAGTGAGAGCGGCGCGCGGCTGATCGA
CCAGTTGATGGACGCCCACCTGTTGCCACAAATCGCCGACCGTCTGCTCGACGCCATGGCCGCCGGCGAG
ACCCTGCGCCAGGTTCACGCCACGCTGGACAGCGATGCTCGTCCGGTCTGCGAGTTCAGTTGA