SecReT6
Protein ID: 472323949
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03865
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]836613..837620 [-]
Producthypothetical protein
NoteTssG
UniProt IDM4XBC7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.00E-88, Aligned region: 17..321
Protein Sequence: 335 a.a.     [Download]
>gi|472323949|ref|YP_007656195.1| hypothetical protein H681_03865 [Pseudomonas denitrificans ATCC 13867]
MDAAHGAAAPALSRLRRDIREYSLFQAVQLVIERLREAGAAEDEEALYDRLEFQANPSLGFPGSDIHSVQ
FFEENGVLRARLRINLIGLFGSGSPLPAFYGEQALGDSEDGNPTRDFLDLFHHRLQRLLLPVWQKYRYHA
RFRSGAIDALSERLFALIGLGGAQLRQAEELNWKRLLPYLGLLSLRAHSAALIEAVLRYYFKHADLFIEQ
CLERQVEILEEQRNRLGLANSRLGEDLVLGEQVRDRSGKFRVHIRELDWERFHEFLPIGTGYQPLCALVR
FTLRDPLDYDLRLELRHDAIRELRIGADNPCRLGWTSWLGREHADGIVTLGSRIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c837620-836613 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGACGCCGCGCATGGGGCAGCAGCCCCTGCTCTGAGCAGGCTGCGCCGCGACATCCGCGAATACTCGC
TGTTCCAGGCGGTGCAGTTGGTCATCGAGCGCCTGCGTGAGGCCGGCGCGGCGGAAGATGAAGAAGCACT
CTACGACCGCCTCGAATTCCAGGCCAACCCGAGCCTGGGCTTCCCCGGCAGCGATATCCACAGTGTGCAG
TTCTTCGAGGAGAACGGCGTGTTGCGCGCTCGCCTGCGCATCAATCTGATCGGCCTGTTCGGCTCGGGCT
CGCCGCTACCGGCGTTCTACGGCGAACAGGCGCTGGGCGACAGCGAGGACGGCAACCCGACGCGGGACTT
CCTCGACCTCTTCCATCACCGCCTGCAGCGCCTGCTGCTGCCGGTCTGGCAGAAGTACCGCTACCACGCG
CGCTTCCGCAGCGGCGCCATCGACGCGCTGTCCGAGCGCCTGTTCGCCCTGATCGGCCTGGGTGGCGCGC
AGCTGCGCCAGGCCGAGGAACTGAACTGGAAGCGCCTGCTGCCCTACCTCGGCCTGCTCAGCCTGCGCGC
CCACTCGGCAGCCCTGATCGAAGCCGTACTGCGCTACTACTTCAAGCACGCCGACCTGTTCATCGAGCAA
TGCCTGGAGCGCCAGGTGGAAATCCTCGAAGAACAGCGCAACCGCCTGGGCCTGGCCAACAGTCGGCTCG
GCGAGGACCTGGTGCTCGGCGAACAGGTGCGCGACCGCAGCGGCAAGTTCCGCGTGCACATCCGCGAGCT
GGACTGGGAGCGCTTCCACGAATTCCTGCCCATCGGCACCGGCTACCAGCCGCTCTGTGCCCTGGTGCGC
TTCACCCTGCGCGATCCCCTGGACTACGACCTGCGCCTGGAGTTGCGCCACGACGCCATTCGCGAACTGC
GCATCGGCGCCGACAACCCCTGCCGCCTTGGCTGGACCAGTTGGCTCGGCCGCGAGCACGCCGACGGCAT
CGTCACTCTCGGCAGCCGCATTCATTAA