SecReT6
Protein ID: 472323950
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03870
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]837584..839371 [-]
Producthypothetical protein
NoteTssF
UniProt IDM4WU11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-187, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|472323950|ref|YP_007656196.1| hypothetical protein H681_03870 [Pseudomonas denitrificans ATCC 13867]
MSFNHYYQSELTALRQLGRRFSERSPALAPFLAQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSILQFDPQANAGPALQVPRETPVESKPIDDVSCRFRTCFPTEVTALQTAGVNYSV
KGEGAILSLRLEMSCPGHLGELDLQRLRLYLAGERYISQMLYLCLLNNLDSIELVPLDERQQPLLDAQDR
PLTLRLPGERVQPVGFAEDEAMIPYPLNTFRGYRFLQEYFAFQDKFLFVDLLGLDRLNELTEAQLKETRG
LEIRFDIHRSGIQRLRPTLDNLKLHCTPIVNLFKHDALPIRLDGKQDEYLLLPAEFDAQHCGVFAVESVT
GWSPGGIGHQDYVLFESFEHDASFDVPTARPHYSVRQRTSLLHEGLDTYLSFGIRDHESHETLSIELTCT
NQNLPRRLKLGDICLPSDQTPDSLRFRNITPVTPSYAPPLNRDFLWKLISNMSLNYLSLANVEALKVILE
TYDLPRYYDQHAEKVSKRLLGGLKSINHQHVDRLHRGLPVRGLRTELTVDPEGYICEGDLFVFASVLNEF
FALYASLNSYHELRVKSTQGEVYQWTPRMGQQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c839371-837584 Pseudomonas denitrificans ATCC 13867, complete genome
ATGTCATTCAACCACTACTACCAGAGCGAACTCACCGCCCTGCGCCAACTGGGACGCCGCTTCTCCGAGC
GCAGTCCGGCGCTGGCGCCGTTCCTTGCGCAGGCGGGGCGCGACCCGGATGTCGAGCGCCTGCTCGAGGG
CTTCGCCTTCCTCACCGGGCGCCTGCGGCAGAAGCTCGATGACGAACTGCCCGAGCTGACCCACTCGCTG
ATGCACCTGCTGTGGCCGAACTACATGCGGCCGCTGCCGGCGTTCAGCATTCTGCAGTTCGACCCGCAGG
CCAACGCCGGCCCGGCTCTGCAGGTGCCGCGCGAGACGCCGGTGGAAAGCAAGCCGATCGACGACGTCAG
CTGCCGCTTCCGCACCTGCTTCCCCACCGAAGTCACCGCGCTGCAAACCGCCGGCGTGAACTACTCGGTC
AAGGGTGAAGGCGCGATCCTCAGCCTGCGCCTGGAAATGAGCTGCCCCGGCCACCTGGGCGAGCTGGACC
TCCAGCGCCTGCGCCTGTACCTGGCGGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCTGAA
CAACCTCGACAGCATCGAACTGGTGCCGCTCGACGAGCGTCAGCAACCTCTGCTCGACGCCCAGGATCGT
CCCCTGACCTTGCGCCTGCCAGGCGAGCGCGTGCAGCCGGTGGGCTTCGCCGAAGACGAGGCGATGATTC
CCTACCCGCTCAACACCTTCCGCGGCTATCGCTTCCTGCAGGAATACTTCGCCTTCCAGGACAAGTTCCT
GTTCGTCGACCTGCTCGGCCTGGACCGCCTGAACGAGCTGACCGAAGCGCAGCTCAAGGAAACCCGTGGC
CTGGAAATCCGCTTCGACATCCATCGCAGCGGCATCCAGCGCCTGCGTCCGACCCTGGACAACCTCAAGC
TGCACTGCACGCCCATCGTCAACCTGTTCAAGCATGACGCGCTGCCGATTCGCCTGGACGGCAAGCAGGA
CGAATACCTGCTGCTGCCGGCCGAGTTCGATGCCCAGCACTGCGGCGTGTTCGCCGTGGAAAGCGTCACC
GGCTGGAGCCCCGGCGGCATCGGCCACCAGGACTACGTGTTGTTCGAATCCTTCGAGCACGATGCCAGCT
TCGACGTACCCACCGCTCGCCCGCACTACAGCGTGCGCCAGCGCACCTCGCTGCTGCACGAGGGCCTGGA
CACCTACCTGAGCTTCGGCATCCGCGACCACGAGTCCCACGAGACGCTTTCCATCGAGCTCACCTGCACC
AACCAGAACCTGCCGCGCCGCCTGAAGCTGGGCGACATCTGCCTGCCCAGTGACCAGACGCCGGACTCGC
TGCGCTTCCGCAACATCACGCCCGTCACGCCCAGCTATGCGCCACCGCTGAACCGCGACTTCCTCTGGAA
GCTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCTAACGTCGAGGCACTCAAGGTGATCCTCGAA
ACCTATGACCTGCCGCGCTACTACGACCAGCACGCGGAAAAAGTCAGCAAGCGCCTGCTCGGCGGCCTCA
AATCGATCAACCACCAGCACGTCGACCGCCTGCACCGGGGACTGCCGGTGCGCGGGCTGCGCACCGAGCT
GACGGTCGATCCCGAGGGCTACATCTGCGAGGGCGATTTGTTCGTCTTCGCCTCGGTCCTCAACGAATTC
TTCGCGCTCTACGCCAGCCTCAACTCGTACCACGAGCTGAGGGTCAAAAGCACACAGGGAGAGGTGTACC
AATGGACGCCGCGCATGGGGCAGCAGCCCCTGCTCTGA