SecReT6
Protein ID: 472323957
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03905
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]842835..843338 [-]
Producthypothetical protein
NotePAAR
UniProt IDM4WRG1
KEGG IDpdr:H681_03905
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.20E-18, Aligned region: 2..50
PAAR_motif [PF05488], Evalue: 2.20E-18, Aligned region: 58..83
PAAR_motif [PF05488], Evalue: 2.20E-18, Aligned region: 73..95
PAAR_motif [PF05488], Evalue: 2.20E-18, Aligned region: 141..156
DUF4150 [PF13665], Evalue: 1.10E-06, Aligned region: 2..14
DUF4150 [PF13665], Evalue: 1.10E-06, Aligned region: 25..47
DUF4150 [PF13665], Evalue: 1.10E-06, Aligned region: 51..99
Protein Sequence: 167 a.a.     [Download]
>gi|472323957|ref|YP_007656203.1| hypothetical protein H681_03905 [Pseudomonas denitrificans ATCC 13867]
MSGKPAARLSDPTACPLPGHGTNPIAAGSPDVLFEGLPAARQGDPSACGGAMASNVIPNVLINGMPAATV
GTVGSHGNVVVSGSGTVVIGTSHAAAPFTPPSPLSLGGFDCQCLLHDDSGQGLANLSYRFLSSNGKEQIG
VTCSQGKTSLISTGESADTLTLYVWGE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c843338-842835 Pseudomonas denitrificans ATCC 13867, complete genome
ATGTCCGGAAAACCCGCCGCCCGCCTCAGTGATCCGACGGCTTGCCCGCTGCCGGGGCACGGCACCAACC
CGATCGCCGCCGGCTCGCCCGACGTGCTGTTCGAGGGCCTGCCCGCCGCGCGCCAGGGCGACCCATCCGC
CTGTGGCGGCGCCATGGCGAGCAACGTGATCCCCAATGTGCTGATCAATGGCATGCCGGCGGCCACGGTC
GGGACCGTCGGCAGCCATGGGAACGTGGTGGTGAGTGGATCGGGGACGGTGGTGATCGGGACGAGCCATG
CGGCGGCGCCTTTCACTCCCCCTTCGCCATTGAGCCTCGGGGGATTCGATTGCCAGTGCCTGCTGCATGA
CGATTCCGGGCAAGGCCTCGCCAATCTGAGCTACCGCTTCTTGTCCTCCAACGGTAAGGAACAGATCGGG
GTGACCTGTTCCCAGGGGAAAACAAGCCTGATCAGTACTGGCGAAAGCGCCGATACGCTGACTCTGTACG
TCTGGGGAGAGTGA