SecReT6
Protein ID: 472323958
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03910
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]843349..843756 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDM4WSF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-19, Aligned region: 26..114
Protein Sequence: 135 a.a.     [Download]
>gi|472323958|ref|YP_007656204.1| GPW/gp25 family protein [Pseudomonas denitrificans ATCC 13867]
MKGYGSLFERLGGEAAERSGWSPEVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDMRLSLHDSLNQ
ARTAIERFIEAYEPRLSAVRVISLPRDHDPLNLAFAIEGLLEVDGLRRQVSFSASLDGSGQVKVQ
 
Nucleotide Sequence: 408 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c843756-843349 Pseudomonas denitrificans ATCC 13867, complete genome
ATGAAAGGATACGGCAGTCTGTTCGAGCGCCTGGGCGGCGAAGCCGCCGAGCGTTCCGGCTGGAGCCCGG
AGGTGGCCGCCATGGCCTCGGTGGCTGCCCATCTGGCCAAAATGCTCAGCACCCGTGCGGGCAGCGTGCA
GACGCTGCCCGACTACGGGCTGCCCGACCTGAACGACATGCGCCTGAGCCTGCACGATTCGCTGAACCAG
GCGCGCACGGCCATCGAGCGCTTCATCGAAGCGTACGAGCCCCGCCTATCCGCGGTTCGCGTCATATCCC
TGCCACGCGACCACGACCCGCTGAACCTGGCCTTCGCCATCGAAGGCCTGCTGGAGGTCGACGGTCTCCG
CCGCCAGGTCAGCTTCTCCGCCAGCCTAGACGGCAGCGGACAGGTCAAGGTCCAGTAA