SecReT6
Protein ID: 472323959
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03915
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]843771..845246 [-]
Producthypothetical protein
NoteTssC
UniProt IDM4XBD7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.10E-193, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|472323959|ref|YP_007656205.1| hypothetical protein H681_03915 [Pseudomonas denitrificans ATCC 13867]
MSTSAVQETTGAGVEYGILDRIIAETSLTPDDEAYGIAKRGVSAFIEELLKPQNQGEQVKKALVDRMIAE
IDAKLSQQMDEILHHAEFQALESSWRGLKLLIDRTNFRENIKVEILNVSKQDLLDDFEDSPEVVQSGLYK
HIYTAEYGQFGGQPVGAIVANYYFSPSAPDVKTMQYVASVSSMSHAPFISAAGPKFFGLDSFTGLPDLKD
LKDHFEGPQFAKWQSFREQEDSRYVGLTVPRFLLRNPYDPEDNPVKTFVYKENVANDHEHYLWGNTAFTF
ASKLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSANSVQKPKFFGISEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLEL
ELNKWIRQYVADQENPSAEVRSRRPLRAAQVIVSDVEGEPGWYRVSLSVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c845246-843771 Pseudomonas denitrificans ATCC 13867, complete genome
ATGAGCACTAGCGCAGTACAGGAAACCACCGGGGCCGGCGTCGAGTACGGCATTCTCGACCGCATCATCG
CCGAGACCAGCCTGACCCCCGACGACGAAGCCTATGGCATCGCCAAGCGCGGCGTATCGGCCTTCATCGA
AGAACTGCTCAAGCCGCAGAACCAGGGCGAGCAGGTCAAGAAGGCGCTGGTCGACCGCATGATCGCCGAG
ATCGACGCCAAGCTCAGCCAGCAGATGGACGAGATCCTCCACCACGCCGAGTTCCAGGCCCTGGAATCCT
CCTGGCGCGGCCTCAAGCTGCTGATCGACCGCACCAACTTCCGCGAGAACATCAAGGTCGAGATCCTCAA
CGTCTCCAAGCAGGACCTGCTGGACGACTTCGAGGACTCCCCGGAAGTGGTCCAGTCCGGCCTCTACAAG
CACATCTACACCGCCGAGTACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCGTCGCCAACTACTACT
TCTCGCCGAGCGCTCCTGACGTCAAGACCATGCAGTACGTGGCCAGCGTCTCGAGCATGTCCCACGCGCC
GTTCATCTCCGCCGCCGGTCCGAAGTTCTTCGGCCTGGACAGCTTCACCGGCCTGCCGGACCTGAAGGAC
CTGAAGGACCATTTCGAAGGCCCGCAATTCGCCAAGTGGCAGAGCTTCCGCGAACAGGAGGACTCCCGCT
ACGTCGGCCTGACCGTGCCGCGCTTCCTGCTGCGCAACCCGTACGATCCGGAAGACAACCCGGTGAAGAC
CTTCGTCTACAAGGAGAACGTCGCCAACGACCACGAGCATTACCTGTGGGGCAACACGGCGTTCACCTTC
GCCAGCAAGCTGACCGACTCCTTCGCCAAGTTCCGCTGGTGTCCGAACATCATCGGCCCGCAGAGCGGTG
GCGCGGTGGAAGACCTGCCGTTGCACCACTTCGAAAGCATGGGTGAGATCGAGACCAAGATCCCCACCGA
GGTGCTGGTCTCCGACCGCCGCGAGTACGAGCTGGCCGAGGAAGGCTTCATCTCCCTGACCATGCGCAAG
GGCAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGTGCAGAAGCCGAAATTCTTCGGCATCAGCGAGG
AAGGCAAGACCGCGGAGCTGAACTACAAGCTCGGCACCCAGCTGCCTTACCTGTTCATCGTCAACCGCCT
GGCCCACTACCTGAAGGTGCTGCAGCGCGAGCAGATCGGCGCGTGGAAAGAGCGTACCGACCTGGAGCTT
GAGCTGAACAAGTGGATCCGCCAGTACGTGGCCGACCAGGAGAACCCCAGCGCCGAAGTCCGCAGCCGCC
GTCCGCTGCGCGCCGCCCAGGTGATCGTCAGTGACGTCGAGGGCGAACCGGGCTGGTACCGCGTCAGCCT
GAGCGTGCGCCCGCACTTCAAGTACATGGGTGCGGACTTCACGCTGTCGCTGGTCGGCAAGCTCGACAAG
GAATGA