SecReT6
Protein ID: 472323960
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03920
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]845274..845774 [-]
Producthypothetical protein
NoteTssB
UniProt IDM4WU19
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-56, Aligned region: 5..159
Protein Sequence: 166 a.a.     [Download]
>gi|472323960|ref|YP_007656206.1| hypothetical protein H681_03920 [Pseudomonas denitrificans ATCC 13867]
MAKEGSVAPKERVNITFKPATGNAQEELELPLKLLVLGDFTQRADDRKVEDRKPIGIDKNNFDEVLAKQE
LSLTLNVPNRLQDEAAGEELGVSLKVNSMKDFNPASLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDDSRDRVLGELGLTDKQDA
 
Nucleotide Sequence: 501 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c845774-845274 Pseudomonas denitrificans ATCC 13867, complete genome
ATGGCCAAAGAAGGCTCGGTCGCCCCCAAGGAACGCGTCAACATCACTTTCAAGCCCGCCACCGGCAACG
CTCAGGAAGAGCTCGAGCTCCCCCTGAAGCTGCTGGTTCTCGGCGACTTCACTCAGCGCGCCGACGACCG
CAAGGTCGAGGATCGCAAGCCGATCGGCATCGACAAGAACAACTTCGACGAAGTGCTGGCCAAGCAGGAA
CTGAGCCTGACCCTCAACGTCCCCAACCGTCTGCAGGACGAAGCCGCCGGCGAAGAGCTGGGCGTCTCGC
TGAAGGTCAACTCGATGAAGGACTTCAACCCGGCGAGCCTGGTGGAACAGGTACCGGAGCTGAAGAAACT
GATGGAGCTACGCGACGCCCTGGTCGCCCTCAAGGGCCCGCTGGGCAATGCGCCGGCCTTCCGCAAGGCC
ATCGAAAGCGTGCTCGCCGACGACGATTCGCGCGACCGCGTACTGGGTGAGCTGGGCCTCACCGATAAGC
AGGACGCCTGA