SecReT6
Protein ID: 472323961
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03925
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]845809..847365 [-]
Producthypothetical protein
NoteTssA
UniProt IDM4WVD1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-23, Aligned region: 55..116
Protein Sequence: 518 a.a.     [Download]
>gi|472323961|ref|YP_007656207.1| hypothetical protein H681_03925 [Pseudomonas denitrificans ATCC 13867]
MSHSKKLVSHYLELAATPISAGDFAGEDVRYSPEYESLETELAKTSSLHGNGLVDWQKVIDVSEGILRTQ
SKDLRIAAWMTWALQQRESFAGLQAGLATLLQLCEKHWDEVHPRKDRTRAAAIGWLIPRLEPLFNESLAI
KEQLQLFRQLAEQLRSLDECLTARLNSEAPLMLPLCRRVDEMIQRASQGQPEPGSVGAVVAQVKQAATNL
LAPVSAIENEKDAHKALRIQQDNARPLCSWWLRQKATDLRALRLNRTLLWLPIDSLPERNAEQTTALRSL
PPDKLRSYSERFEQGHYADLLVDLETSLARAPFWFDGQRLAWECLQALDAEAAMREVEIQFALFLQRLPG
VVELKFFDGNPFAEPATRAWISSHVMPHLQTPSAPREVATTTESSAWELALEEAVPLLRREGLKSAVQRL
KQGLQGAQGGRERFFWHLSMARLCQQAKKYELAKTQLEALDEQLQESALHQWEPDLALEVLHLLHTCCEL
LPQNHSVRERKDEVYRRLCHLDLEVVLD
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c847365-845809 Pseudomonas denitrificans ATCC 13867, complete genome
ATGAGCCATTCCAAGAAACTCGTATCGCATTATCTCGAGCTGGCCGCTACTCCAATATCGGCAGGAGATT
TCGCGGGCGAGGACGTACGCTACTCGCCCGAATACGAGAGTCTGGAGACGGAGCTCGCGAAGACCTCGTC
TCTGCATGGCAACGGTCTGGTGGACTGGCAGAAGGTCATCGATGTCAGCGAGGGCATTCTCCGTACCCAG
TCCAAGGATCTGCGCATCGCCGCCTGGATGACCTGGGCCCTGCAGCAACGCGAATCCTTCGCTGGCCTGC
AGGCTGGCCTGGCCACGCTTCTGCAGCTATGCGAGAAGCACTGGGACGAGGTGCACCCACGCAAGGACAG
GACCCGCGCCGCCGCTATCGGCTGGCTGATTCCACGACTGGAGCCACTGTTCAACGAGAGTCTGGCGATC
AAGGAACAATTGCAGCTGTTCCGTCAGTTGGCGGAACAGCTGCGGAGCCTGGACGAATGCCTGACGGCAC
GCCTGAACAGCGAAGCGCCGCTGATGCTGCCACTATGCCGGCGAGTGGACGAGATGATCCAGCGCGCTTC
CCAGGGCCAGCCCGAACCGGGCTCGGTGGGAGCAGTGGTCGCCCAGGTCAAGCAAGCGGCCACCAACCTC
CTTGCCCCAGTGAGCGCCATCGAGAACGAGAAGGACGCACACAAGGCGCTGCGTATCCAGCAGGACAACG
CCCGCCCCCTGTGCAGTTGGTGGCTGCGCCAGAAGGCCACCGACCTGCGCGCCCTACGCCTGAACCGAAC
ATTGCTCTGGCTGCCGATTGACAGCCTTCCCGAGCGCAACGCCGAGCAGACCACCGCGTTGCGCAGCCTG
CCCCCCGACAAGCTGCGTTCCTACAGCGAACGCTTCGAGCAGGGCCACTACGCCGACCTGCTGGTCGATC
TGGAAACCAGCCTGGCGCGCGCGCCCTTCTGGTTCGACGGCCAGCGCCTGGCCTGGGAATGCCTGCAGGC
GCTCGATGCCGAGGCGGCGATGCGCGAGGTGGAGATCCAGTTCGCGCTGTTTCTGCAGCGATTGCCCGGT
GTCGTCGAGCTGAAGTTCTTCGACGGCAACCCCTTCGCCGAGCCGGCCACTCGCGCCTGGATCAGTTCCC
ATGTGATGCCGCACCTGCAGACCCCCTCCGCGCCACGCGAAGTCGCCACCACCACGGAGTCGTCCGCCTG
GGAACTGGCCCTGGAAGAGGCTGTGCCGCTACTGCGCAGGGAAGGGCTCAAAAGCGCCGTGCAACGCCTC
AAACAAGGCCTGCAGGGCGCCCAGGGCGGCCGTGAACGTTTCTTCTGGCACTTGAGCATGGCGCGCCTGT
GCCAGCAGGCGAAGAAGTACGAGCTGGCCAAGACCCAGCTGGAGGCCCTCGACGAACAACTGCAGGAATC
CGCCCTGCACCAATGGGAACCCGATCTCGCCCTCGAGGTGCTGCACTTGCTGCACACCTGCTGCGAGTTG
CTGCCGCAGAACCACAGCGTTCGCGAACGCAAGGACGAGGTCTATCGCAGGCTGTGCCACCTCGATCTCG
AAGTGGTGCTCGACTAG