SecReT6
Protein ID: 472323963
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03935
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]848690..850744 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDM4WSF8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.60E-73, Aligned region: 29..323
Phage_GPD [PF05954], Evalue: 8.60E-73, Aligned region: 525..566
Phage_base_V [PF04717], Evalue: 7.20E-26, Aligned region: 372..465
DUF2345 [PF10106], Evalue: 0.00056, Aligned region: 547..582
DUF2345 [PF10106], Evalue: 0.00056, Aligned region: 575..617
Protein Sequence: 684 a.a.     [Download]
>gi|472323963|ref|YP_007656209.1| Rhs element Vgr protein [Pseudomonas denitrificans ATCC 13867]
MFAPANQTHFSLSIEDASSDLQVLEFTGREALNQPFHFELELVSDNPALELESLLHKAAYLAIGQDGAGI
HGQVYRVSQGESGKRLTRYQVSLVPRLAYLAHRFNQRIFQQLSVPQIIGKVLEEHGILADAYRFQLGPTV
YPKRDYCTQYDESDLHFIQRLCEEEGIHYHFEHSAQQHLLVFGDDQTCFPKLAPLAYQQDSGLVADVPVV
RRFGQRLETRTSRTTRRDYHFEKPRLDLESAARSDVKPDLEDYDYPGRFTDRERGKHLSQRALERHRSDF
VLCEGRSDQPSLRSGHFLSLTGHPRADWNDLWLLTEIHHEGKQPQVLEESISSDTTELKDDFHQGYRNRF
AATPWNVPYRPPLEHPKPRILGSQSAVVTGPAGEEIHCDPYGRVKVQFFWDREGQADDKTSCWLRVASSW
AGKQFGAIAIPRVGMEVLVSFLEGDPDQPLVSGCLYHAENQVPYELPANKTRSLFKTNSYPGGDGFNELR
IEDRKGQEQIFVHAQRDWDENIEHDQRIRIGHERHDTVEANTYSEFRAEEHHTTHGDRKVELRSDDHLTV
GNNQHLKIGTGQFVEAGQEIHLSGGLKVVMEAGSELTLKAGGSFVKLDAGGITLSGATVKVNSGGSPGSG
APAVPLLPGPLQQADADKPGLPLEALVKQMLVFRQSRSGICEVCEAAKAQGAQG
 
Nucleotide Sequence: 2055 bp     [Download]
>gi|472323176|ref|NC_020829.1|:848690-850744 Pseudomonas denitrificans ATCC 13867, complete genome
ATGTTCGCCCCGGCCAACCAGACTCATTTCAGCCTGAGCATCGAAGACGCCAGCAGCGATCTGCAGGTGC
TCGAGTTCACCGGGCGAGAGGCCCTGAACCAGCCCTTTCACTTCGAACTCGAACTGGTCAGCGACAACCC
TGCGCTGGAGCTGGAAAGCCTGCTGCACAAGGCCGCCTACCTGGCCATCGGGCAGGATGGAGCCGGCATT
CATGGCCAGGTCTACCGGGTGTCCCAGGGCGAGTCCGGCAAGCGCCTGACCCGCTACCAGGTCAGCCTGG
TGCCGCGCCTGGCCTACCTGGCCCATCGCTTCAACCAGCGGATATTCCAGCAACTGAGCGTGCCGCAGAT
CATCGGCAAGGTACTGGAAGAGCATGGCATCCTCGCCGACGCCTATCGCTTCCAGCTCGGCCCGACCGTC
TATCCCAAGCGTGACTATTGCACGCAGTACGACGAGTCCGACCTGCACTTCATTCAGCGCCTGTGCGAAG
AGGAGGGCATTCACTACCACTTCGAGCACAGCGCCCAGCAGCACTTGCTGGTCTTCGGCGACGACCAGAC
CTGCTTCCCGAAACTGGCCCCACTGGCCTACCAGCAGGATTCCGGCCTGGTGGCCGACGTACCGGTGGTC
CGCCGCTTCGGCCAGCGCCTGGAAACCCGCACCAGCCGCACGACCCGCCGCGACTACCATTTCGAGAAGC
CTCGGCTCGACCTCGAAAGCGCCGCCCGCAGCGACGTCAAGCCGGACCTCGAAGACTACGACTACCCCGG
CCGCTTCACCGACCGCGAGCGCGGCAAGCACCTCAGCCAGCGCGCGCTGGAGCGCCACCGCAGCGACTTC
GTCCTCTGCGAAGGGCGCAGTGACCAGCCCAGCCTGCGCAGCGGGCATTTCCTCTCGTTGACCGGGCACC
CGCGCGCCGACTGGAACGACCTCTGGCTGCTCACCGAAATCCACCACGAAGGCAAGCAGCCCCAGGTGCT
GGAAGAATCCATCAGCAGTGACACCACCGAGCTCAAGGACGACTTCCATCAGGGCTATCGCAACCGTTTC
GCCGCCACGCCTTGGAACGTGCCCTATCGCCCGCCGCTGGAGCATCCGAAGCCGCGCATCCTCGGCAGCC
AGAGCGCCGTAGTGACCGGTCCCGCCGGGGAGGAAATTCATTGCGACCCGTACGGCCGGGTCAAGGTGCA
GTTCTTCTGGGACCGCGAGGGGCAGGCCGACGACAAGACCAGTTGCTGGCTGCGTGTCGCCTCCAGTTGG
GCCGGCAAGCAGTTCGGCGCCATCGCCATTCCGCGCGTGGGTATGGAGGTGCTGGTCAGTTTCCTCGAGG
GTGATCCGGACCAGCCGCTGGTATCCGGCTGCCTCTACCATGCCGAGAATCAGGTGCCGTACGAGCTGCC
GGCGAACAAGACCCGCAGCCTGTTCAAGACCAACAGCTACCCTGGCGGCGATGGTTTCAACGAACTGCGT
ATCGAGGACCGCAAGGGCCAGGAGCAGATATTCGTCCACGCCCAGCGCGACTGGGACGAGAACATCGAGC
ACGACCAGCGCATCCGCATCGGCCATGAACGCCACGACACGGTCGAGGCGAACACCTACAGCGAGTTCAG
GGCCGAAGAGCACCACACCACCCACGGCGACCGCAAGGTCGAACTGCGCAGCGACGATCATCTCACCGTC
GGTAACAACCAGCACCTCAAGATCGGCACCGGCCAGTTCGTCGAGGCCGGCCAGGAGATTCATCTGTCCG
GCGGCCTGAAAGTGGTGATGGAAGCGGGCAGCGAACTGACGCTCAAGGCCGGCGGCAGCTTCGTCAAGCT
GGATGCCGGCGGCATCACGCTCAGCGGCGCCACGGTGAAGGTGAACAGTGGCGGCAGTCCCGGAAGCGGG
GCGCCGGCGGTGCCGTTGTTGCCGGGGCCATTGCAGCAGGCGGATGCGGACAAGCCCGGACTTCCCCTTG
AGGCGTTGGTGAAGCAGATGCTGGTATTCAGACAAAGTCGGTCTGGCATTTGTGAGGTGTGTGAAGCCGC
CAAGGCGCAGGGAGCACAAGGATGA