SecReT6
Protein ID: 473827765
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0366
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]393388..395001 [+]
Producthypothetical protein
NoteFha
UniProt IDM5DMZ9
KEGG IDtol:TOL_0366
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.00E-16, Aligned region: 29..95
Protein Sequence: 537 a.a.     [Download]
>gi|473827765|ref|YP_007681048.1| hypothetical protein TOL_0366 [Thalassolituus oleivorans MIL-1]
MDLILTVVKCPSHANMLNHTKVFRGVGGRIGRADSNDWVLPDTDRILSSQHAEISFTAGQFFVVDHSTNG
TFINESQVPLGAGNNHPLANGDIINCGEYHLKVTLKAPPAAPGIPKDLGAVDFLDSGDKTTFNPATAAKQ
QVANDAKDLDRWLDPAAAVPKPSFESDTWGSAASSAPASKAADDPWGAAVSPTANASILNDASNVDPLAA
LDNSQSFGSPKAPSWDDNDDWWKSGSEADNSPVDQQQIRIPSPAAPTPPPLQQAASSQPSPAFAMPQQST
PAFGDNPFAASSAGIQHEDIDSLLGISSPAASQPVPPPPPVAPVMPSAPSQPQAAEAPSYNANELQQLAT
LLGIDNIQPAQLQTLIPEMSSIINETVTRLIDLLRARTAIKNELRVQHTMIQMTDNNPLKFSATATDALK
VMFSKDRSAFMRPTEAIQDSFDDLSDHQVAVLTGMNTAYTAMLNHFNPESLKRYINVGDSLLGNKNAKNW
SAFEQYYKSLKSDRETTYNKLFGEEFARSYEKQLAELKNARALKRRS
 
Nucleotide Sequence: 1614 bp     [Download]
>gi|473827406|ref|NC_020888.1|:393388-395001 Thalassolituus oleivorans MIL-1 complete genome
ATGGATTTAATTTTGACAGTGGTTAAATGTCCATCACATGCGAACATGCTCAACCACACCAAAGTGTTTC
GGGGTGTTGGCGGTCGTATTGGTCGTGCCGACTCTAACGATTGGGTGTTGCCGGATACTGATCGGATTCT
ATCGTCTCAGCATGCTGAAATTAGCTTTACCGCTGGGCAGTTTTTCGTTGTTGATCACAGTACTAATGGT
ACGTTTATCAATGAAAGCCAAGTTCCTCTTGGGGCTGGCAACAATCATCCTTTGGCCAATGGCGACATTA
TTAATTGTGGTGAGTATCACTTAAAGGTCACGCTAAAAGCTCCTCCGGCAGCTCCGGGTATTCCAAAAGA
TTTAGGCGCGGTCGATTTTTTAGACTCGGGTGATAAAACCACATTTAATCCGGCCACTGCAGCAAAGCAG
CAAGTGGCCAATGATGCGAAAGACTTAGATCGTTGGCTTGATCCTGCGGCAGCCGTTCCTAAGCCGTCGT
TTGAAAGCGATACGTGGGGCTCGGCTGCATCAAGTGCACCTGCCTCTAAAGCCGCAGATGATCCATGGGG
TGCTGCTGTATCGCCTACGGCAAACGCCTCAATTTTGAACGATGCTAGCAATGTTGATCCGCTTGCCGCG
TTAGATAATTCACAGTCGTTTGGCTCGCCGAAAGCGCCGAGCTGGGATGATAATGATGACTGGTGGAAAT
CCGGCAGCGAGGCTGATAATTCGCCTGTTGATCAACAGCAAATTCGTATCCCTTCGCCCGCTGCGCCCAC
GCCTCCTCCGTTGCAGCAAGCTGCATCTAGTCAGCCGTCGCCTGCGTTTGCAATGCCACAGCAGTCAACC
CCTGCTTTTGGCGATAATCCCTTTGCGGCATCCAGTGCTGGCATACAACACGAAGATATTGATAGCCTAC
TAGGAATTTCTTCTCCTGCAGCATCGCAGCCAGTGCCGCCGCCTCCACCGGTTGCGCCTGTGATGCCGTC
AGCTCCGTCGCAACCGCAAGCTGCGGAAGCGCCATCTTATAATGCAAACGAGTTACAGCAGCTGGCGACA
TTGTTAGGAATCGACAATATTCAACCGGCACAGCTGCAGACTCTTATTCCTGAGATGTCGAGCATTATTA
ATGAAACGGTTACTCGCCTAATTGATTTATTGCGTGCTAGAACAGCCATTAAAAATGAGTTGCGTGTCCA
GCACACCATGATTCAAATGACGGATAATAATCCGTTGAAATTTTCAGCAACAGCGACCGATGCACTGAAA
GTGATGTTTAGCAAAGATCGTTCTGCTTTTATGCGTCCGACTGAAGCTATTCAAGATAGCTTTGATGATT
TATCCGACCACCAAGTGGCGGTGTTAACGGGTATGAATACCGCCTATACCGCCATGTTGAATCACTTTAA
TCCGGAAAGTTTAAAGCGCTATATTAACGTGGGTGATTCATTGCTAGGCAATAAAAATGCTAAAAATTGG
TCTGCGTTCGAGCAGTACTATAAATCATTGAAAAGTGATCGCGAGACAACCTATAACAAGTTATTTGGTG
AAGAGTTTGCTCGTAGCTATGAAAAGCAATTAGCTGAATTGAAAAACGCACGAGCATTAAAGCGCCGCTC
GTAA