SecReT6
Protein ID: 473827766
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0367
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]395043..395576 [+]
Producthypothetical protein
NoteTssJ
UniProt IDM5DZ61
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-26, Aligned region: 16..152
Protein Sequence: 177 a.a.     [Download]
>gi|473827766|ref|YP_007681049.1| hypothetical protein TOL_0367 [Thalassolituus oleivorans MIL-1]
MFKSLFYCASIAVLAVTLSGCQSARKALNFDTSAVINFSALNNINPDSDDRASPVVVHVFKLADDRQFSR
EDFLSLYEGAEARLGKDLLGSVVLKEITPGESRSEVIGLPPEVKFIGLMAEFIQYRNADAIMVFPIVEHN
QNIFDIAIDSNKLSVYQEPENNDLHEASRPVRSDRIH
 
Nucleotide Sequence: 534 bp     [Download]
>gi|473827406|ref|NC_020888.1|:395043-395576 Thalassolituus oleivorans MIL-1 complete genome
ATGTTTAAATCGCTGTTTTATTGTGCATCAATTGCCGTATTGGCTGTGACGCTAAGTGGATGTCAGTCGG
CCCGTAAGGCACTTAATTTTGATACCTCCGCTGTAATTAATTTTTCCGCATTAAATAATATCAATCCTGA
TTCCGACGATCGAGCGTCACCTGTGGTTGTGCATGTGTTTAAACTTGCCGATGACCGCCAGTTTAGTCGC
GAAGATTTTCTGAGTTTGTACGAGGGTGCTGAAGCGCGTTTAGGTAAAGACTTGCTAGGTTCTGTAGTGC
TGAAGGAAATCACGCCCGGAGAATCACGCAGTGAGGTGATTGGCTTGCCGCCAGAGGTGAAATTTATTGG
CCTGATGGCCGAGTTTATTCAATACCGCAATGCCGACGCCATTATGGTATTTCCAATCGTAGAGCATAAT
CAAAATATCTTTGATATCGCGATTGATAGTAACAAATTGTCGGTATATCAAGAACCTGAAAACAACGACC
TCCACGAAGCCTCTCGGCCAGTGAGAAGTGACCGAATTCATTAG