SecReT6
Protein ID: 473827767
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0368
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]395668..397002 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDM5DLV4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-151, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|473827767|ref|YP_007681050.1| type VI secretion protein [Thalassolituus oleivorans MIL-1]
MSSKNKVIWSEGMFLRPQHFQQQDRFVERLIDARTGVIGQHYWGVQEITIDVEALALGKVSISSVQGVFP
DGTPILAPESEELPNIIDIPENTRDEIVYLCVPMRRPGSQESVRDEEEFPQARYKTYNYDARNSASSSGE
SSRIQIGKLSTCFKLGSEDLGGYACIGIARIIERLPGSPVKLDKTFIPPVLQCTSSAEIKGYIEEVKGLL
KQRGEALSHRLSDSGRSGSAEVADYLLLQVINRVEPLINHLSQLSNVHPLALYTELLQLAGELSTFTASN
KRPPDIPAYNHEDLQQTYAGLFSALRQSLSMVLEQSAVSLNLVERKYGIHVAPITDPSLTKTAAFVIAVK
ADIPTELLRSRFPSQAKLAPVENIRELISTQLPGLRIRPLPVAPRQIPYHAGFTYFEIDASGALWTAMQQ
SGGFAVHLGAEFPGLIMELWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|473827406|ref|NC_020888.1|:395668-397002 Thalassolituus oleivorans MIL-1 complete genome
ATGTCTTCAAAAAATAAAGTGATATGGTCTGAGGGCATGTTTCTTCGCCCGCAGCATTTTCAGCAGCAAG
ATAGATTTGTTGAACGGCTAATTGATGCAAGGACAGGTGTCATTGGTCAGCATTATTGGGGTGTACAAGA
AATAACCATCGATGTCGAGGCTTTGGCTCTTGGCAAGGTGTCTATATCTTCGGTTCAGGGGGTATTCCCT
GATGGCACACCTATTCTGGCACCAGAGTCAGAAGAGCTACCGAATATTATCGATATTCCCGAAAATACTC
GGGATGAAATTGTTTATCTATGTGTGCCTATGCGTCGCCCTGGCTCGCAAGAATCTGTGCGTGATGAAGA
AGAATTTCCGCAGGCGCGCTACAAAACCTACAACTATGATGCGCGCAATAGCGCTTCATCGTCTGGTGAG
TCATCACGCATTCAAATTGGTAAGTTATCGACGTGCTTTAAGCTCGGATCAGAAGATTTGGGTGGCTATG
CCTGTATTGGTATTGCACGAATTATCGAACGCTTGCCAGGTAGCCCCGTTAAGCTCGACAAAACCTTTAT
TCCGCCGGTATTACAGTGTACTAGCAGCGCAGAAATTAAGGGCTACATTGAAGAAGTTAAAGGCCTGCTA
AAACAGCGCGGCGAAGCTTTAAGCCATCGTCTTAGTGACTCGGGTCGTTCGGGCTCGGCAGAGGTTGCCG
ATTATTTGTTACTGCAAGTTATCAATCGCGTGGAGCCTTTGATCAACCACCTGAGTCAACTATCCAATGT
TCATCCTTTAGCTTTATATACTGAGCTATTGCAATTGGCCGGTGAATTATCAACCTTCACTGCTAGTAAT
AAGCGTCCGCCCGATATCCCTGCGTATAATCACGAGGATTTACAGCAGACGTATGCCGGATTATTTTCTG
CATTGCGTCAGTCGCTCAGTATGGTGCTTGAGCAGTCGGCGGTTTCGTTGAACTTGGTTGAACGTAAATA
TGGTATTCATGTTGCACCAATTACCGACCCATCGCTAACCAAAACTGCGGCATTTGTTATTGCTGTAAAA
GCAGATATTCCAACCGAATTATTGCGCAGTCGTTTTCCTTCTCAGGCTAAGTTGGCACCGGTCGAAAATA
TTCGCGAGCTTATTTCGACTCAACTACCGGGTTTGCGTATTCGCCCGTTACCCGTAGCGCCTCGTCAGAT
TCCATATCACGCTGGGTTTACCTATTTTGAGATTGATGCGAGTGGTGCGTTATGGACTGCAATGCAACAG
TCGGGTGGATTTGCCGTTCATTTGGGCGCCGAATTTCCGGGGTTAATTATGGAACTATGGGCAATCAGGA
GCTGA