SecReT6
Protein ID: 473827768
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0369
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]397007..397888 [+]
ProductDotU
NoteTssL
UniProt IDM5DN34
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.00E-72, Aligned region: 51..256
Protein Sequence: 293 a.a.     [Download]
>gi|473827768|ref|YP_007681051.1| DotU [Thalassolituus oleivorans MIL-1]
MSGDRPIPGGADRTVIIPTPGAARGAQTPPPAAGNFGLQSNERIEIKTGLNPLVNSATTLLTLVIKLRST
MQHANVPDLHKRLTEEIKAFESKTRNAGIAGDSVIAARYLLCSVIDEVVLNTPWGASSGWSQHSLLSLFH
QETSGGEKCFLILQRMLETPGIHLDVLELFYICLSLGFQGKYRVVSGGGQQIEQIRDNLYKTIESHRPVP
AHDLSPNWEGTVKAKDRMANFIPLWVFASVVLAALLLTFSGFRYWLYQTTDPVASKIAAEMTTSEILEKN
TVSPEPNTERRFY
 
Nucleotide Sequence: 882 bp     [Download]
>gi|473827406|ref|NC_020888.1|:397007-397888 Thalassolituus oleivorans MIL-1 complete genome
ATGAGCGGTGATCGACCAATTCCAGGCGGCGCTGACCGTACGGTTATAATTCCTACGCCGGGAGCGGCAC
GCGGCGCACAAACGCCACCGCCTGCGGCAGGAAATTTTGGCTTGCAGTCGAATGAGCGTATTGAGATTAA
GACAGGCTTAAATCCATTGGTTAATTCAGCAACTACCTTGCTGACATTGGTTATTAAGCTGCGTTCGACC
ATGCAGCACGCCAATGTACCGGATTTACACAAACGCCTTACCGAGGAAATAAAAGCATTTGAGAGTAAAA
CCCGTAATGCCGGTATTGCCGGTGATAGCGTTATTGCTGCACGGTATTTACTCTGTTCCGTCATTGATGA
AGTTGTATTGAATACGCCGTGGGGCGCATCAAGTGGCTGGAGTCAGCATTCCTTGCTGAGCCTGTTTCAT
CAAGAAACATCCGGCGGCGAGAAATGCTTTTTAATTCTTCAGCGTATGTTGGAAACCCCAGGCATTCATT
TAGATGTACTGGAGTTGTTTTACATTTGTTTAAGTCTTGGTTTTCAAGGTAAATATCGTGTTGTATCTGG
CGGCGGCCAGCAGATTGAGCAAATTCGAGATAATTTGTACAAGACAATAGAAAGTCATCGCCCAGTGCCA
GCGCATGATTTATCGCCTAATTGGGAAGGCACCGTTAAGGCAAAAGATCGTATGGCGAATTTTATTCCGC
TATGGGTCTTTGCCAGCGTTGTCTTGGCGGCTTTGTTGTTAACTTTTTCTGGCTTTCGTTACTGGCTGTA
TCAGACCACCGATCCCGTTGCGAGTAAGATTGCGGCAGAAATGACGACGTCCGAAATATTAGAAAAAAAT
ACAGTTTCACCAGAACCAAACACGGAAAGACGGTTTTATTAG