SecReT6
Protein ID: 473827771
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0372
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]402292..403545 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDM5DZ67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.90E-22, Aligned region: 66..126
Protein Sequence: 417 a.a.     [Download]
>gi|473827771|ref|YP_007681054.1| type VI secretion-associated protein, ImpA family [Thalassolituus oleivorans MIL-1]
MPFGYVIDIDSLVAPISDDMPQGSDVRADRSPTSDYYVIKDARNNARAAERSAMFGDVEVDLYTPWVTVS
ELATKILSSQSKDLEVATWYLESLIRLNGVSGLRDGMKLINQLVNDHWDGLFPMPDEDGIETRVAPLTGL
NGDGGEGTLLAPLRNIEITIDGDHGAFSFWQYQQARDADRIDDEDRKAERISTLGYSLSSVNDTIAQTDI
QTCRNFIETIEEALAAYKETSSKLRELCGGDAPPSSKITELLDEVLRTTRFAYKEKIQAADDADAAAAAV
SEPSEVSSDETVTTSQVVHMTNAAAGPITNREDALKRLEEVAKYFRQYEPHTPLAPSLERIVSWGRMTVA
ELMMELIPDSTARSLYSQFTGVMLDGSDTHSYVAPPVVKPATSQTTPTSQGAADAAPAAEPAAKMGW
 
Nucleotide Sequence: 1254 bp     [Download]
>gi|473827406|ref|NC_020888.1|:402292-403545 Thalassolituus oleivorans MIL-1 complete genome
ATGCCATTTGGTTATGTTATCGATATTGATAGCTTAGTTGCCCCCATTAGTGATGATATGCCGCAGGGAA
GCGATGTAAGAGCCGATCGTTCCCCCACATCTGATTACTATGTCATTAAAGACGCCCGAAATAATGCTCG
AGCAGCAGAACGCTCGGCGATGTTTGGCGATGTTGAAGTTGATTTGTACACCCCTTGGGTTACTGTTTCT
GAGTTAGCAACTAAGATTTTGTCTTCTCAATCTAAGGATTTAGAAGTTGCCACTTGGTACCTCGAAAGCC
TAATTCGCCTTAATGGCGTTTCTGGTCTAAGAGATGGTATGAAATTAATTAATCAATTAGTTAATGATCA
TTGGGATGGTCTATTTCCAATGCCTGACGAAGATGGCATTGAGACTCGTGTTGCACCACTCACAGGTTTA
AATGGTGACGGCGGTGAAGGTACTTTATTAGCGCCATTACGCAATATCGAAATTACGATTGACGGCGATC
ATGGGGCGTTCAGTTTTTGGCAATATCAGCAGGCTCGTGATGCTGATCGAATCGACGATGAAGATCGCAA
AGCTGAGCGTATTTCAACGCTTGGATACAGTCTATCTTCAGTAAATGACACGATCGCCCAGACCGATATT
CAGACCTGCCGTAATTTTATTGAAACCATCGAAGAAGCATTAGCGGCCTACAAAGAAACCAGCAGTAAAT
TACGTGAATTATGTGGCGGCGATGCTCCTCCAAGCTCAAAAATTACAGAATTATTAGACGAAGTTTTACG
TACCACGCGTTTCGCCTATAAAGAAAAAATCCAAGCGGCGGATGACGCCGATGCTGCAGCCGCAGCTGTC
TCAGAACCGAGCGAAGTATCATCGGACGAAACCGTTACTACAAGCCAGGTCGTACATATGACTAATGCTG
CCGCAGGCCCAATTACTAATCGCGAAGATGCCCTCAAGCGCCTTGAAGAAGTTGCTAAATATTTCCGTCA
GTACGAACCTCATACGCCTCTTGCGCCTAGCTTAGAGCGTATTGTGTCATGGGGCCGAATGACAGTAGCA
GAGCTAATGATGGAGCTGATTCCAGACAGTACAGCTCGTAGCCTTTATTCGCAGTTTACCGGGGTGATGT
TGGATGGCAGCGATACCCATTCATATGTTGCGCCACCAGTGGTTAAACCGGCCACTAGCCAAACGACACC
TACATCTCAAGGGGCGGCAGACGCTGCGCCAGCGGCGGAACCAGCTGCGAAAATGGGATGGTAA