SecReT6
Protein ID: 473827772
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0373
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]403605..404123 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDM5DLV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-60, Aligned region: 9..163
Protein Sequence: 172 a.a.     [Download]
>gi|473827772|ref|YP_007681055.1| type VI secretion protein [Thalassolituus oleivorans MIL-1] [TssB]
MSESIHNKLKRVRKPRVHITYDVETNGAEVKKELPFVTGVMGDYSGDNTENRKALKDRKFVQIDRDNFNE
AMGKVNPKLNLQVENTLAGDGSKVAIDLDFKKMDDFTPEAIVSQVEPLKKLLDARNKLRDLLSKADRSED
LENVLEEILKNTDNITAISKELGIGEAKEGAE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|473827406|ref|NC_020888.1|:403605-404123 Thalassolituus oleivorans MIL-1, complete sequence [TssB]
ATGTCCGAAAGTATTCACAATAAATTGAAGCGAGTTCGTAAGCCTCGCGTACATATTACGTATGACGTTG
AAACTAACGGTGCAGAAGTTAAGAAGGAACTGCCATTTGTAACGGGTGTTATGGGCGACTATTCCGGTGA
TAACACTGAGAACCGCAAAGCGCTTAAAGATCGTAAATTCGTTCAAATTGATCGTGATAACTTCAACGAA
GCGATGGGTAAAGTAAATCCTAAGCTTAACCTTCAAGTTGAAAATACGTTAGCCGGTGACGGTAGCAAGG
TTGCAATTGATCTCGACTTCAAAAAAATGGATGACTTCACACCAGAAGCCATCGTTTCTCAGGTTGAGCC
ATTGAAAAAGCTACTAGATGCGCGTAACAAACTACGTGACTTGTTGAGCAAAGCAGATCGTTCAGAAGAT
CTCGAAAACGTTCTTGAAGAAATTTTGAAAAATACCGACAACATTACCGCTATTTCGAAAGAGCTTGGTA
TCGGTGAAGCTAAGGAAGGAGCTGAATAA