SecReT6
Protein ID: 473827773
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0374
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]404123..405607 [+]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDM5DN37
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-190, Aligned region: 62..491
Protein Sequence: 494 a.a.     [Download]
>gi|473827773|ref|YP_007681056.1| type VI secretion protein, EvpB/family [Thalassolituus oleivorans MIL-1]
MSTELETSGGAVAEEQSFSLLEQAISSTKQTEREETQDLLANLTEQVLKGTVTWDRNLTNTIKQAVAAID
EAMSRQLTAILHDEKFQKLEGSWRGLNHLVMNSETSSTLKIRMLNISKRELFRDLDKAVEFDQSQIFKKL
YEEEFGTAGGEPYGAMIGDFEFTSHPEDVDLLANMSNVAAAGFCPFISAAGAGMFGFDDFTELSKPRDLG
AIFESQEYIKWRSFRDSEDSRFVTLVMPRVLSRLPYGAASKPVESFNFEEFELDESGMSKAAGHDDYCWM
NAAYVMGTTLTRAFAENSWCTAIRGAEGGRVEGLPSHIFKSDDGDTDQKCPTEVGITDRREAELSNQGFL
PLCHYKNTDYSVFFGAQSAQKQKVYDDPDATANASISARLPYLMATSRIAHYLKVMARDKVGSFMQAENC
ERWLNQWISQYTNSNPDASAEMKAKYPLAEARVEVKEIPGQPGAYSAVAYLKPWLQMEELTTSLRMVANI
PQPK
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|473827406|ref|NC_020888.1|:404123-405607 Thalassolituus oleivorans MIL-1 complete genome
ATGAGTACTGAATTAGAAACCTCTGGCGGCGCAGTCGCCGAAGAGCAATCGTTTAGCTTATTAGAACAAG
CAATTAGTTCAACTAAGCAAACTGAGCGCGAAGAAACTCAAGACCTTTTGGCTAACCTGACTGAACAGGT
TTTAAAGGGTACAGTGACTTGGGATCGCAACCTAACCAATACCATTAAGCAAGCGGTTGCAGCAATTGAT
GAAGCTATGTCTCGTCAATTAACGGCAATTCTTCATGACGAAAAATTCCAAAAATTGGAAGGTTCATGGC
GCGGCCTTAATCACTTGGTGATGAATTCTGAAACCAGCTCTACGCTGAAAATTCGCATGCTTAACATTTC
TAAGCGCGAATTGTTCCGTGACCTTGATAAAGCGGTTGAATTCGATCAAAGCCAAATCTTCAAAAAATTA
TACGAAGAAGAATTCGGTACTGCCGGTGGTGAACCATACGGCGCTATGATCGGTGACTTCGAATTCACTA
GCCACCCAGAAGACGTCGATTTGTTAGCTAATATGTCTAACGTTGCGGCGGCTGGTTTCTGCCCATTCAT
CTCTGCCGCTGGTGCAGGTATGTTTGGTTTTGATGATTTTACTGAGCTATCTAAGCCACGCGATTTAGGT
GCGATTTTCGAATCTCAGGAATACATCAAATGGCGTAGCTTCCGCGATAGCGAAGATTCTCGCTTCGTAA
CGCTAGTAATGCCACGCGTACTTTCTCGCTTGCCGTATGGTGCTGCCTCTAAGCCAGTTGAAAGCTTCAA
TTTTGAAGAATTCGAATTGGATGAGTCCGGCATGTCAAAAGCTGCTGGCCATGACGATTACTGCTGGATG
AATGCCGCTTATGTTATGGGCACAACCCTAACTCGTGCATTCGCAGAAAACTCTTGGTGTACCGCTATTC
GTGGTGCTGAAGGTGGCCGTGTTGAAGGCTTACCATCACACATCTTTAAGAGTGATGACGGGGATACCGA
TCAGAAGTGCCCAACTGAAGTGGGTATTACTGACCGTCGTGAAGCAGAGCTTTCGAACCAAGGCTTCTTG
CCACTATGTCACTACAAAAATACCGATTACTCAGTATTTTTTGGTGCGCAGTCTGCACAAAAGCAAAAGG
TTTATGACGATCCAGATGCAACGGCTAACGCCTCTATCTCTGCACGTCTTCCATACTTGATGGCGACTTC
TCGTATTGCTCATTACTTAAAAGTGATGGCACGCGATAAAGTGGGTTCATTTATGCAGGCAGAGAATTGC
GAGCGCTGGTTAAACCAGTGGATCTCTCAATACACCAACTCAAATCCAGATGCGTCCGCAGAGATGAAAG
CTAAGTACCCACTAGCTGAAGCTCGCGTTGAGGTAAAAGAAATTCCAGGTCAACCTGGCGCATACAGCGC
GGTTGCCTACCTCAAGCCTTGGCTGCAAATGGAAGAACTGACGACTTCTCTTCGTATGGTTGCGAACATT
CCACAACCTAAGTAA