SecReT6
Protein ID: 473827774
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0375
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]405622..407193 [+]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDM5DNT7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-156, Aligned region: 84..515
Protein Sequence: 523 a.a.     [Download]
>gi|473827774|ref|YP_007681057.1| type VI secretion protein, EvpB/family [Thalassolituus oleivorans MIL-1]
MRSAHPFLFVIHFKGTKVLTDSSSIDRVHKNPSLLGSPDTQTLPLADIYTFLAEKDDVAAFSLWLNHFAV
SKINRNYSVKRWLNQQIAEIDELISEQVNAVLHDARFQRLESSWRGLWFLVEAAVASDNIKIRLLDVNWK
DLSKDIERAPDFDQSGLFHLIYNEEFGTPGGEPFGVLLGDYYVSHRPYEGHRYDDVFTLQGISRAAAAAF
CPFVCSAAPQLFGLDSYDTLGLPINLDNVFRADEYIRWRSLREREDSRFLALTLPNLLMRKPYERNYNSP
QGMHFVEDVAGKNNNKYLWGNACFALGSVLIREFSEVGWFSHIRGVPRDYLGGGLVTQFPSLSYKTDSSK
AMVKMSTSVTITDQLERELSDLGLISLCHCYQTPYAVFNNCPSLQVSKNYGNKSANANARISSMLQQILC
GSRFAQYIKVIIRDKVGSYVTADACQRFLQDWLDEYTTGRDDLSWEMMARYPLREARVRVVEEPGKPGHY
SSIVHLKTHYTVDHLVSELKLTTALNQIETGKV
 
Nucleotide Sequence: 1572 bp     [Download]
>gi|473827406|ref|NC_020888.1|:405622-407193 Thalassolituus oleivorans MIL-1 complete genome
ATGCGCTCTGCGCATCCCTTTTTATTCGTTATTCATTTTAAGGGAACTAAAGTGCTGACAGATTCTTCAA
GCATTGATCGGGTGCATAAGAATCCTTCTTTGTTAGGTTCTCCCGATACACAAACACTCCCTTTGGCTGA
CATCTATACGTTTCTTGCTGAAAAAGATGACGTAGCCGCATTTTCCCTCTGGCTAAATCATTTCGCCGTT
AGCAAAATCAATCGTAATTATTCAGTTAAGCGTTGGCTCAATCAGCAAATTGCCGAAATAGACGAACTCA
TTTCTGAACAAGTCAATGCTGTTCTCCATGATGCTCGTTTTCAGCGTCTTGAAAGTTCATGGCGAGGACT
ATGGTTTCTGGTGGAGGCTGCCGTCGCATCCGATAACATCAAAATTCGTTTGTTGGATGTTAACTGGAAA
GACTTATCGAAAGACATTGAACGAGCTCCAGATTTCGATCAAAGCGGGCTGTTTCATTTAATTTACAACG
AAGAATTTGGTACTCCAGGTGGCGAGCCATTTGGCGTATTGCTCGGTGACTATTACGTATCGCATCGCCC
GTACGAAGGTCATCGCTACGACGATGTCTTTACCTTGCAGGGGATTAGTCGAGCTGCTGCCGCTGCATTT
TGCCCTTTTGTTTGCAGTGCTGCGCCACAATTGTTCGGCCTCGATAGTTACGATACGTTAGGCTTGCCAA
TCAACCTAGATAACGTTTTTCGTGCCGATGAATATATTCGGTGGCGTTCGCTACGAGAACGCGAAGATAG
TCGTTTCTTAGCATTAACATTGCCGAATTTATTGATGAGAAAACCTTACGAGCGTAATTATAACTCGCCC
CAAGGTATGCATTTTGTCGAAGACGTAGCGGGTAAAAACAACAATAAATATTTGTGGGGCAATGCCTGCT
TTGCGCTAGGCTCGGTCTTGATCCGTGAATTCTCCGAGGTCGGTTGGTTTAGCCATATTCGCGGTGTACC
ACGCGACTATTTGGGTGGCGGTTTAGTAACGCAATTTCCATCATTGAGTTATAAAACGGATAGCTCAAAA
GCTATGGTGAAAATGTCGACTTCGGTCACGATCACCGACCAATTGGAACGGGAACTGAGTGATCTTGGTT
TGATTTCGTTGTGCCACTGCTATCAAACGCCATATGCAGTATTTAATAACTGTCCATCGCTGCAAGTTTC
AAAAAACTACGGCAATAAATCGGCCAATGCCAACGCGCGAATTAGTTCTATGTTGCAACAAATATTATGC
GGCTCTCGATTCGCGCAATACATCAAAGTGATCATTCGCGATAAAGTCGGTTCTTATGTTACTGCTGATG
CCTGTCAGCGTTTTTTACAAGATTGGCTAGATGAATATACAACAGGGCGCGATGACCTATCGTGGGAAAT
GATGGCTCGTTATCCTCTACGTGAGGCCCGCGTGAGGGTTGTCGAAGAGCCGGGGAAGCCGGGTCATTAC
TCAAGTATCGTACACTTAAAAACGCATTACACCGTTGATCACTTAGTGTCGGAGTTGAAGTTAACTACGG
CACTAAATCAAATAGAAACAGGTAAGGTTTAG