SecReT6
Protein ID: 473827775
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0376
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]407195..407674 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDM5DN06
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-23, Aligned region: 36..138
Protein Sequence: 159 a.a.     [Download]
>gi|473827775|ref|YP_007681058.1| type VI secretion system lysozyme-related protein [Thalassolituus oleivorans MIL-1]
MVNKREKRLLAPVLDRLLEQNQSSDFRQSHRIQRCLRESIRRDLENLFNTRYCCVSPPEAYKNLDDSVLN
YGLPDLSTINMSSFDSRNDFCRKIEKTVLKYEPRIKTVKVKTDAVLDNEDPTIRFRVEATLHMNPVQELM
IFESTLNPINQTVNVSELF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|473827406|ref|NC_020888.1|:407195-407674 Thalassolituus oleivorans MIL-1 complete genome
ATGGTTAATAAGCGTGAGAAGCGGCTATTAGCCCCCGTGCTAGATCGCCTACTAGAACAAAATCAAAGCA
GTGATTTTCGCCAAAGCCACCGTATACAACGCTGCCTGCGTGAAAGTATTCGTCGCGATTTAGAAAACTT
ATTCAACACTCGCTACTGCTGTGTATCGCCACCAGAAGCTTATAAAAATTTAGATGACTCAGTGTTGAAC
TATGGTCTGCCTGATTTATCGACCATTAATATGAGTTCATTTGATAGCCGCAATGACTTCTGTCGAAAAA
TCGAGAAAACGGTTCTTAAATACGAACCTAGAATCAAGACCGTAAAAGTGAAAACCGATGCGGTCCTTGA
TAACGAAGATCCAACCATACGTTTTAGAGTTGAAGCAACACTGCATATGAACCCAGTACAAGAGCTCATG
ATATTTGAATCGACGTTAAACCCGATCAATCAAACGGTCAACGTTTCGGAGTTATTCTAA