SecReT6
Protein ID: 473827776
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0377
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]407675..409507 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDM5DZ73
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.00E-194, Aligned region: 5..610
Protein Sequence: 610 a.a.     [Download]
>gi|473827776|ref|YP_007681059.1| type VI secretion protein, VC_A0110 family [Thalassolituus oleivorans MIL-1]
MSDRLLYHYEKELAFIKQSASEFAKQHPSAAENLQLGSDSVDDPLVARLLSGFAFLNARIQQKLSDDFPE
LTDAMLETLYPHYLRPIPSMAIAQFSPLDDLDAAITIPANTELETDTSQNQECLFTTRYPVELLPIRLDS
AQLMPKPFVAPGSFDIQGASAVLKLSFKSLSADLRIADMDLSKIRLFLKGQAQHVHPLYDLILTKCFRVV
IANGDADIKPTILNSDALKQVGFDIAEGLLPYPSSSFMGYRLLTEFFSFQEKFQFIDFTQLDIGINNSFD
DTLNIYLYLRESDIELEHQVNVGMFALGCTPIVNIFEQIADPIPLTHTESEYPIVPDARRREGLEIYSVV
NAGATDSDGKYTPYRPFYGIDHSQNQKQKSAFWLTSRREIFEGEHRNELASEMNIRLVDLNFNPYELSDQ
SLDLQLLCTNRNLPRKLPTGQGQPFMQVVDNEYPTEKISCVVNPTSTIRPPLRERGYWRLISHLNLNHLS
LSNGGGSVEAIKEILRLYDFRDSASTRNMIDSIMAIHTKPITAPIQIEGLVSMCRGTQIELTLDPIMLAG
TSPLMFSSVLERFFGLYGSINSFTRLIITLNGKDGEFKRWPPRAGEKALI
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|473827406|ref|NC_020888.1|:407675-409507 Thalassolituus oleivorans MIL-1 complete genome
ATGAGCGATAGATTGCTTTATCACTACGAAAAAGAACTGGCATTTATTAAGCAATCGGCTTCTGAGTTTG
CTAAACAGCATCCGTCAGCTGCTGAAAATTTACAGCTTGGTAGTGACTCCGTAGATGATCCGCTCGTTGC
TCGTTTGCTTTCAGGTTTTGCATTTTTAAATGCGCGTATTCAGCAGAAACTCAGTGATGATTTTCCTGAG
TTAACCGATGCTATGCTTGAAACCTTATACCCGCATTATCTGCGTCCGATTCCATCCATGGCCATTGCTC
AATTCTCGCCTTTGGATGACCTTGATGCGGCTATCACGATTCCTGCAAACACTGAGCTAGAAACCGATAC
TAGCCAAAATCAGGAGTGCCTATTTACTACGCGCTATCCAGTCGAATTATTACCGATACGATTGGATTCA
GCGCAATTGATGCCTAAGCCATTTGTTGCCCCCGGTAGTTTTGATATTCAAGGTGCAAGCGCAGTATTAA
AGCTGTCGTTCAAAAGTCTAAGTGCTGATCTACGTATTGCCGATATGGATCTCAGTAAGATTCGCCTCTT
CTTAAAAGGGCAGGCGCAGCATGTTCATCCGTTATACGACCTGATTCTTACCAAGTGTTTTCGTGTTGTC
ATTGCCAATGGCGATGCGGATATCAAACCCACCATTTTAAATTCAGACGCGTTGAAGCAAGTGGGTTTTG
ATATTGCAGAAGGGCTGTTGCCGTATCCTAGTTCATCCTTTATGGGTTACCGTTTACTAACTGAGTTTTT
CTCATTCCAAGAGAAGTTCCAGTTTATCGATTTTACGCAGTTAGATATCGGCATTAACAATAGCTTTGAT
GACACCCTAAATATCTATTTGTACCTACGTGAAAGTGATATCGAATTAGAGCATCAAGTGAATGTCGGTA
TGTTTGCCTTAGGCTGCACGCCGATTGTAAATATATTCGAGCAAATTGCCGATCCTATTCCACTAACGCA
TACCGAATCCGAATATCCTATTGTGCCGGATGCACGTCGTCGAGAAGGCCTAGAGATCTATTCTGTGGTT
AATGCTGGCGCGACGGACAGCGATGGCAAGTACACGCCGTACCGTCCTTTTTATGGTATCGATCATAGCC
AAAACCAAAAGCAGAAATCCGCATTTTGGTTAACCAGTCGGCGAGAAATATTCGAAGGTGAGCATCGTAA
CGAACTGGCCTCTGAAATGAATATTCGCTTAGTGGATCTTAATTTTAATCCTTATGAACTAAGCGATCAG
AGTTTAGATTTACAGTTGTTGTGCACTAATCGTAATTTACCGCGTAAATTGCCAACAGGTCAGGGGCAGC
CATTTATGCAAGTGGTTGATAACGAATACCCGACAGAGAAGATATCCTGTGTGGTTAATCCAACATCAAC
CATTCGCCCGCCATTGCGCGAACGCGGCTACTGGCGACTGATATCGCATCTGAATCTAAATCACTTATCG
TTGAGTAATGGTGGCGGTTCAGTAGAGGCGATTAAAGAAATTTTACGCCTTTATGATTTTCGCGATTCTG
CCAGTACACGCAATATGATTGATTCGATAATGGCGATTCATACAAAGCCGATTACCGCGCCTATTCAGAT
TGAAGGGCTGGTATCTATGTGCCGTGGTACGCAGATCGAATTAACCCTCGACCCAATCATGTTAGCAGGC
ACTAGCCCCTTAATGTTTTCGAGTGTATTGGAACGATTTTTTGGTTTATACGGTTCGATCAACTCGTTTA
CGCGTTTGATTATCACCCTTAATGGTAAAGACGGAGAGTTTAAGAGATGGCCACCTCGCGCCGGCGAAAA
AGCCTTAATCTAG