SecReT6
Protein ID: 473827777
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0378
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]409471..410610 [+]
Producthypothetical protein
NoteTssG
UniProt IDM5DLW0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-77, Aligned region: 18..350
Protein Sequence: 379 a.a.     [Download]
>gi|473827777|ref|YP_007681060.1| hypothetical protein TOL_0378 [Thalassolituus oleivorans MIL-1]
MATSRRRKSLNLVEQLQSEPYRFDFFQATRLLERAANLHPEKDQIATESVGGVARPDQEAVHFRARTSLA
FNGSDVTKVTQKRISNYDSEDNSVLQWQMEVAMMGLTGSQGVMPYYLSEIVLSELRKKSSALKDYLDLFN
HRTISMFYEAWHKYQLVPNYERSKYDSTGKDDLFTDALLSIAGIGLSEQKFRSALPDEQMARFSGHFGRT
ICSAESLRSSICGMFNLDTSIKEFQGEWYDLPSDVHCRMPDSEHPLGTNTELGVNTVIGSRCYQAQNKFS
VVIKPMNEQEFMQLAPGSRTLEELKSFIKMSVGGEQDFDIEIQLSDEHVPLKELMKSEDYEPLLGWNTYI
DPDRLSGDSISIKLSQEIAVPNDDLPMAY
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|473827406|ref|NC_020888.1|:409471-410610 Thalassolituus oleivorans MIL-1 complete genome
ATGGCCACCTCGCGCCGGCGAAAAAGCCTTAATCTAGTAGAACAACTCCAGTCTGAACCTTATCGGTTTG
ATTTTTTTCAAGCGACAAGGTTACTGGAGCGAGCAGCTAATCTACATCCCGAAAAAGACCAAATCGCAAC
AGAAAGTGTTGGGGGCGTGGCACGCCCAGATCAAGAGGCCGTGCATTTTCGCGCACGCACTAGTTTAGCG
TTTAACGGTTCAGACGTTACTAAAGTAACGCAAAAACGCATTTCCAATTACGACTCAGAGGATAATTCAG
TTCTGCAATGGCAGATGGAAGTCGCCATGATGGGATTGACTGGCAGTCAGGGCGTGATGCCGTATTACCT
CAGTGAAATTGTTCTATCCGAACTGCGTAAAAAGAGCTCAGCCTTAAAAGATTACCTCGATCTTTTTAAT
CACCGCACCATCTCCATGTTTTACGAGGCATGGCATAAATACCAATTGGTGCCAAATTACGAGCGCAGTA
AGTACGATTCAACAGGAAAAGATGACCTTTTTACCGATGCTTTGCTGTCTATTGCGGGTATTGGCTTATC
GGAACAGAAATTTCGCTCGGCGTTGCCCGATGAGCAAATGGCGCGCTTTTCGGGTCATTTTGGTCGAACC
ATCTGTTCTGCAGAATCGCTGCGTAGCAGCATTTGCGGCATGTTTAATTTAGACACTAGCATTAAAGAAT
TTCAGGGGGAGTGGTACGACCTGCCATCCGATGTTCATTGCCGCATGCCCGATAGCGAACACCCTCTGGG
AACAAATACCGAGCTTGGTGTAAATACCGTGATCGGCTCGCGCTGCTATCAAGCGCAGAACAAATTCTCG
GTTGTTATTAAACCGATGAACGAACAGGAGTTTATGCAGCTTGCTCCCGGTTCACGTACGTTAGAGGAGC
TTAAATCCTTTATTAAAATGAGCGTCGGTGGTGAGCAAGATTTCGATATCGAAATTCAATTATCCGATGA
ACATGTACCGTTAAAAGAGCTCATGAAGTCTGAAGACTACGAGCCACTGCTGGGCTGGAATACGTACATA
GATCCAGATCGCCTGAGTGGCGACTCGATCTCAATTAAATTATCACAGGAGATTGCCGTTCCTAATGACG
ATTTGCCAATGGCATATTAA