SecReT6
Protein ID: 473827778
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0379
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]410673..413333 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDM5DN40
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.40E-39, Aligned region: 56..76
AAA_2 [PF07724], Evalue: 3.40E-39, Aligned region: 617..783
AAA [PF00004], Evalue: 3.30E-21, Aligned region: 229..361
AAA [PF00004], Evalue: 3.30E-21, Aligned region: 623..750
ClpB_D2-small [PF10431], Evalue: 1.50E-12, Aligned region: 790..867
AAA_16 [PF13191], Evalue: 8.70E-12, Aligned region: 36..67
AAA_16 [PF13191], Evalue: 8.70E-12, Aligned region: 206..250
AAA_16 [PF13191], Evalue: 8.70E-12, Aligned region: 273..307
AAA_16 [PF13191], Evalue: 8.70E-12, Aligned region: 461..486
AAA_16 [PF13191], Evalue: 8.70E-12, Aligned region: 598..643
AAA_16 [PF13191], Evalue: 8.70E-12, Aligned region: 684..716
AAA_5 [PF07728], Evalue: 4.60E-11, Aligned region: 229..249
AAA_5 [PF07728], Evalue: 4.60E-11, Aligned region: 302..359
AAA_5 [PF07728], Evalue: 4.60E-11, Aligned region: 623..742
AAA_22 [PF13401], Evalue: 4.40E-09, Aligned region: 229..310
AAA_22 [PF13401], Evalue: 4.40E-09, Aligned region: 346..443
AAA_22 [PF13401], Evalue: 4.40E-09, Aligned region: 621..702
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 28..73
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 106..134
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 316..326
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 515..539
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 547..561
Sigma54_activat [PF00158], Evalue: 6.50E-06, Aligned region: 211..243
Sigma54_activat [PF00158], Evalue: 6.50E-06, Aligned region: 622..746
AAA_14 [PF13173], Evalue: 2.30E-05, Aligned region: 229..319
AAA_14 [PF13173], Evalue: 2.30E-05, Aligned region: 358..395
AAA_14 [PF13173], Evalue: 2.30E-05, Aligned region: 623..791
AAA_14 [PF13173], Evalue: 2.30E-05, Aligned region: 770..797
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 208..246
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 281..384
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 623..643
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 690..712
Zeta_toxin [PF06414], Evalue: 0.00017, Aligned region: 225..249
Zeta_toxin [PF06414], Evalue: 0.00017, Aligned region: 613..663
NACHT [PF05729], Evalue: 0.00041, Aligned region: 229..255
NACHT [PF05729], Evalue: 0.00041, Aligned region: 422..461
NACHT [PF05729], Evalue: 0.00041, Aligned region: 624..649
AAA_17 [PF13207], Evalue: 0.00046, Aligned region: 230..248
AAA_17 [PF13207], Evalue: 0.00046, Aligned region: 622..660
IstB_IS21 [PF01695], Evalue: 0.00077, Aligned region: 223..248
IstB_IS21 [PF01695], Evalue: 0.00077, Aligned region: 474..498
IstB_IS21 [PF01695], Evalue: 0.00077, Aligned region: 622..643
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 229..249
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 277..309
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 585..658
AAA_18 [PF13238], Evalue: 0.0029, Aligned region: 231..244
AAA_18 [PF13238], Evalue: 0.0029, Aligned region: 624..652
AAA_19 [PF13245], Evalue: 0.0042, Aligned region: 227..253
AAA_19 [PF13245], Evalue: 0.0042, Aligned region: 626..644
AAA_25 [PF13481], Evalue: 0.0077, Aligned region: 229..306
AAA_25 [PF13481], Evalue: 0.0077, Aligned region: 440..482
AAA_25 [PF13481], Evalue: 0.0077, Aligned region: 619..646
AAA_25 [PF13481], Evalue: 0.0077, Aligned region: 685..706
Protein Sequence: 886 a.a.     [Download]
>gi|473827778|ref|YP_007681061.1| type VI secretion ATPase, ClpV1 family [Thalassolituus oleivorans MIL-1]
MININLKSLVDKMSPYMRDSLEGAAGLCLAHSQYNVELEHWLLKLLDISDTDFMQLLEKHGVNPSNLAKQ
LANTIAKFRSGSSRPAALAPSIVEATKNAWMLASVDYGQTVISSGHLLAALMLDDNSRRQLLESCPELKE
IAPESIRETAKAIYGTTGETDHLLRGDETGATSVAGGNVAATKTPSLDKYTVNLTERAQKGEIDPVLGRD
EEIRQCIDILTRRRQNNPIMTGEAGVGKTAVVEGFALRIAAGDVPDPLKGVAIRTLDLGLLQAGASVKGE
FENRLKSVIEEVRASATPIILFIDEAHTMIGAGGKEGQGDAANLLKPALARGELRTIAATTWAEYKKYFE
RDPALTRRFQVVKVEEPSEEKAIDMMRGISESLQQHHKVRILDEAVIASVVLSHRYIPGRQLPDKSVSLL
DTACARVALSQSSTPSAIEDAERRIQRATLTINKLERESAATGEHEEKLIALKEEKEQAEALLVILRAQY
EQESALISKIRTCRDQIDENFLKAEGDKLTPEALNDLKGELKALTTELNGVQGERPLMQANVDEQAIAEV
IANWTGIPVGKMVSDQITAVQTLADKLGKRVIGQPHALEAVAQVIRTSRAGLTDPRKPVGVFLFCGTSGV
GKTETALALADELYGGEQNITTINMSEFKEEHKVSMLLGSPPGYVGYGEGGILTEAARRKPYSVILLDEM
EKAHPGVQDIFYNLFDKGTIKDGEGRDIDFKNTVIIMTSNAGEDAIRAIFNQVEEKPDPDTLLDNIRPYL
LKHFKSAFMGRANTIAYYPLDDDNLMAIAAINMRKIEKRIVENYGAAFSYDEDVLINIVARCQESDTGAR
NIETILNRTLLPSLASECLNKMANDEEITKVHVGATEDGEFTYTVS
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|473827406|ref|NC_020888.1|:410673-413333 Thalassolituus oleivorans MIL-1 complete genome
ATGATTAATATCAACCTAAAGTCGCTTGTCGACAAAATGTCGCCATACATGCGCGACTCGCTAGAAGGCG
CTGCCGGTCTGTGTCTTGCCCACAGCCAATACAATGTTGAGTTAGAGCACTGGTTGCTTAAATTGCTTGA
TATATCGGATACGGATTTCATGCAGTTGCTGGAAAAGCATGGTGTTAATCCATCGAATTTAGCTAAGCAG
TTGGCAAACACCATTGCCAAATTCCGCTCTGGCAGCAGTCGTCCTGCAGCGCTAGCACCTAGCATCGTTG
AAGCGACAAAGAATGCATGGATGCTTGCGTCTGTGGATTATGGCCAGACGGTGATCAGTTCCGGTCATTT
ATTAGCAGCATTAATGTTAGACGATAACTCACGTCGTCAGTTGTTAGAAAGCTGTCCAGAATTAAAAGAA
ATTGCACCGGAATCCATTCGTGAAACGGCAAAAGCTATATACGGCACCACAGGTGAAACCGATCATCTTT
TAAGGGGGGATGAAACTGGTGCAACTTCCGTAGCAGGCGGTAATGTCGCAGCTACTAAAACGCCATCACT
CGACAAATACACAGTTAACCTGACTGAGCGCGCACAGAAAGGTGAGATTGACCCAGTACTAGGCCGTGAT
GAAGAAATTCGTCAGTGTATTGATATCCTAACTCGTCGTCGTCAAAACAACCCAATTATGACCGGTGAAG
CCGGTGTTGGTAAAACCGCTGTGGTTGAAGGTTTTGCACTGCGTATTGCTGCTGGCGATGTGCCTGATCC
ATTAAAAGGTGTTGCGATACGCACACTTGATCTTGGTTTGTTGCAAGCGGGTGCAAGCGTAAAAGGCGAA
TTCGAAAATCGCTTAAAATCCGTTATTGAAGAAGTTCGCGCCTCAGCCACGCCGATCATTCTATTTATCG
ACGAAGCACACACTATGATTGGTGCCGGCGGTAAAGAAGGCCAAGGTGATGCGGCTAACTTATTAAAGCC
AGCGCTGGCACGTGGTGAGTTACGTACTATTGCTGCAACGACGTGGGCAGAATATAAGAAATACTTTGAA
CGTGACCCAGCATTAACCCGTCGCTTCCAAGTCGTTAAAGTTGAAGAGCCATCAGAAGAGAAAGCCATCG
ACATGATGCGCGGTATTTCTGAGTCGTTACAACAGCATCACAAAGTACGTATTTTAGACGAAGCTGTTAT
TGCTTCGGTTGTTCTATCTCATCGTTATATTCCGGGTCGTCAGTTGCCGGATAAATCCGTTAGTTTATTA
GATACCGCTTGCGCCCGTGTCGCCCTGAGTCAATCATCGACCCCTAGTGCTATTGAGGATGCCGAGCGCC
GCATTCAGCGCGCAACGCTAACCATTAATAAACTAGAGCGTGAATCGGCAGCGACCGGTGAACATGAAGA
AAAATTAATTGCCCTAAAAGAAGAAAAAGAACAAGCCGAGGCGTTATTAGTAATCCTTCGAGCACAGTAT
GAGCAAGAAAGTGCTCTTATTTCAAAAATTCGTACCTGTCGCGATCAAATTGACGAAAATTTCTTAAAAG
CAGAAGGCGATAAGCTAACGCCAGAAGCGCTAAATGATTTAAAAGGCGAACTAAAAGCATTAACCACAGA
ATTAAACGGTGTGCAGGGCGAACGCCCATTAATGCAAGCCAACGTTGATGAACAAGCTATTGCTGAAGTT
ATTGCTAACTGGACGGGTATTCCGGTTGGTAAAATGGTGAGCGATCAAATCACAGCGGTACAAACTTTAG
CCGATAAACTCGGCAAGCGTGTTATTGGCCAACCCCATGCATTAGAAGCCGTCGCTCAAGTGATTCGTAC
CTCGCGTGCCGGTCTAACCGATCCACGCAAACCGGTTGGTGTATTTTTATTCTGCGGTACCAGTGGGGTC
GGTAAAACCGAAACTGCATTGGCGCTAGCAGATGAGTTATATGGTGGCGAGCAAAATATTACCACCATCA
ACATGTCGGAATTTAAAGAAGAGCATAAGGTATCTATGCTGTTGGGTTCACCTCCAGGTTATGTGGGTTA
CGGTGAAGGCGGCATTTTAACTGAAGCCGCACGCCGCAAGCCGTATTCGGTTATCTTGCTCGATGAAATG
GAAAAAGCACATCCCGGCGTACAGGATATTTTCTACAACCTGTTTGACAAAGGCACGATAAAAGACGGTG
AAGGTCGCGATATCGACTTTAAAAATACCGTCATTATTATGACCTCAAATGCGGGTGAAGATGCTATTCG
CGCGATTTTCAATCAAGTAGAAGAAAAGCCAGACCCAGACACGCTACTTGATAATATTCGTCCGTATCTG
CTTAAACACTTTAAATCTGCATTTATGGGCCGAGCGAACACCATCGCGTATTACCCTCTGGATGATGATA
ACTTAATGGCCATCGCAGCGATTAACATGCGCAAAATTGAAAAACGCATTGTTGAAAACTACGGCGCAGC
GTTTAGTTATGACGAAGATGTATTAATCAATATTGTTGCCCGCTGCCAAGAATCAGATACCGGCGCACGT
AATATTGAAACCATACTGAATCGGACATTACTACCCTCATTGGCCAGTGAATGCCTAAATAAAATGGCAA
ACGATGAAGAAATTACCAAAGTGCATGTTGGTGCGACGGAAGATGGTGAATTTACCTACACCGTAAGCTA
A