SecReT6
Protein ID: 473827787
SecReT6 ID745
T6SS typei5
Gene symbol-
Locus tagTOL_0388
StrainThalassolituus oleivorans MIL-1
Repliconchromosome [GenBank: NC_020888] [Browse all T6SS(s) in this replicon]
Location [Strand]422740..423228 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDM5DLW8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.50E-31, Aligned region: 4..136
Protein Sequence: 162 a.a.     [Download]
>gi|473827787|ref|YP_007681070.1| hemolysin-coregulated protein [Thalassolituus oleivorans MIL-1]
MAIYMNFNEKSPAGNVTAAGYEDWIEVDSMSFGVGRSISMQAGAMANREASRPSISEVTITKPLDAASGG
LFKASVTGDSGVKVEIHVVQTGAEKVEKYAVYKLEDVIMSSYSVSASAGGAPQESISLSFAKIEADLTHA
DKTNKNTKNMKVGYDLTTAKPL
 
Nucleotide Sequence: 489 bp     [Download]
>gi|473827406|ref|NC_020888.1|:c423228-422740 Thalassolituus oleivorans MIL-1 complete genome
ATGGCGATTTATATGAATTTCAACGAAAAGTCTCCAGCTGGTAACGTGACCGCAGCCGGCTACGAAGACT
GGATTGAAGTTGACAGCATGAGCTTTGGTGTTGGCCGCTCTATCAGCATGCAAGCTGGTGCAATGGCTAA
CCGTGAAGCTTCTCGTCCAAGCATCAGCGAAGTGACTATCACTAAGCCTTTAGACGCTGCTTCTGGCGGT
CTTTTCAAAGCATCTGTAACGGGTGACTCAGGCGTTAAAGTTGAGATCCACGTAGTTCAAACTGGTGCTG
AGAAAGTTGAAAAGTACGCAGTTTACAAACTAGAAGACGTTATCATGTCTTCTTACAGCGTTAGCGCTTC
AGCTGGCGGTGCTCCACAAGAGTCTATCTCTTTAAGCTTTGCAAAAATCGAAGCTGACCTGACTCACGCA
GACAAGACCAACAAGAACACCAAGAACATGAAAGTTGGTTACGATCTAACGACTGCTAAGCCGTTATAA