SecReT6
Protein ID: 478476278
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00390
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]87825..88505 [-]
Producttype VI secretion-associated protein TagF
NoteTagF
UniProt IDM9RV39
KEGG IDpsg:G655_00390
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 6.10E-51, Aligned region: 5..142
Protein Sequence: 226 a.a.     [Download]
>gi|478476278|ref|YP_007706929.1| type VI secretion-associated protein TagF [Pseudomonas aeruginosa B136-33]
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGGE
AVAGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLP
APPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRF
LTGEGEVIPLFPGIPG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c88505-87825 Pseudomonas aeruginosa B136-33, complete genome
TTGAACAGCGTCGGTTTCTACGGCAAGCTGGCCGGCCGCGGCGATTTCGTCAGCCGCGGCCTGCCGAACA
CCTTCGTCGAACCCTGGGACGCCTGGCTGGCCAGCGGCATGCGCGCCAGCCAGGACGAACTCGGCGCGGC
CTGGCTCGACGCCTACCTGACCAGCCCGCTGTGGCGCTTCGCCATCGCCCCCGGCCTGCTCGGCGGCGAA
GCGGTGGCCGGGGTGGTGATGCCGAGCATCGACCGGGTCGGTCGCTATTTCCCGCTGACCGTCGCCTGCC
TGCTGCCGGCGAACGCCGACCTCGGCGGGCTGGTCGGCGGCGACGACGGCTGGTTCGAGCAGGTCGAGAG
CCTGCTGCTCTCCACCCTCGAACCGGAGGCCGAGGTCGAGGCCTTCGAGCAGGCGGTGGCGCAGCTCCCG
GCCCCTCCCTGCGGACCGCGCATCGAACAATCGCTGATCAGCGGCAACCTGCTGCGCAGCGAAGCGGTGA
CCCCGGCACAGCGCCTCGCCGCGCTGGCCCAGCATGCCTGCGACGGCGCCAGCCACTGGTGGGGACGCGG
CTCGGCACGGATCTCCGCCGGCCTGATGCGCTACCAGGGCCTGCCGCCGGCGCCGGCGTTCGGACGATTC
CTCACCGGAGAGGGCGAGGTGATCCCGCTCTTTCCCGGCATACCCGGTTAA