SecReT6
Protein ID: 478476282
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00410
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]94738..95202 [-]
Productlipoprotein
NoteTssJ
UniProt IDM9RTY5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-43, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|478476282|ref|YP_007706933.1| lipoprotein [Pseudomonas aeruginosa B136-33]
MQKLIIALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDIT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c95202-94738 Pseudomonas aeruginosa B136-33, complete genome
ATGCAGAAACTGATCATCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGTTCGTCCAGCCCGCCGGAAACCC
CGCCGACCCGGGTGGTGATCTGGCTCCACGCCGCACCGAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAAGACACCGCGTTCGGCCGCGCCGACTACTTCGCCCTC
ACCGACAACGCCCAGTCGACCCTCGGCGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAACGGCGCATCGAACGCACGCTCGACGAGCAGACCCGCCAGCTCGGCTTCGTCGCCGCCTACCGCGA
CCTTGACCGCGCCACCTGGCGCCAGGTCCTCGACGTGCCGGGGCAACGCACCAGTCATCTCGACATCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGTCCCGCGCCCTGA