SecReT6
Protein ID: 478476283
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00415
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]95247..96752 [-]
ProductFha1
NoteFha
UniProt IDM9RV42
KEGG IDpsg:G655_00415
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 501 a.a.     [Download]
>gi|478476283|ref|YP_007706934.1| Fha1 [Pseudomonas aeruginosa B136-33]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPLPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVVQPLPTVEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPQPASVAAPTPPASATATAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDV
LRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMA
GVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFGREFSRA
YEEHSARLRRS
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c96752-95247 Pseudomonas aeruginosa B136-33, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTTCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCTGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGTCCAGCCGCTGCCGACGGTCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCACAGCCAGCCAGCGTGGCGGCGCCGACGCCACCGGCAAGCGCCACCGCGA
CGGCCGGCGGCGACCTGCTGCAGGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGACCCGGC
CGGCGCCGAAGCGCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTGGACGTG
CTGCGCGCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGCAGAACA
ACCCGCTGAAGTTCGCGCCGAACGTCGACGAAGCCATGCTGCTCCTGCTGCGCCGCGACAACCAGGCGTT
CATGGCGCCGGATCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCACCAACTGGCGGTGATGGCC
GGCGTGCAGGCCGCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCACTGGAAGCCCGCTTCGGCA
AGCCGGCCGGGCTTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTGGGACAGTTTCACCGAGCT
GTACGCGAAGATCCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGCCGCGAATTCAGCCGCGCC
TATGAGGAACACAGCGCTCGACTACGGCGTTCCTGA