SecReT6
Protein ID: 478476284
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00420
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]97120..98154 [+]
Producthypothetical protein
NoteTssA
UniProt IDM9RSK5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 156..168
Protein Sequence: 344 a.a.     [Download]
>gi|478476284|ref|YP_007706935.1| hypothetical protein G655_00420 [Pseudomonas aeruginosa B136-33]
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKD
LRVANLLLQSNVALDGLDGLAEGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGV
AERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAATGEQGGAAPVAAVAAPAPRASGEIA
NREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|478476202|ref|NC_020912.1|:97120-98154 Pseudomonas aeruginosa B136-33, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCTGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACG
ACGCCGCGTTCCTCGAACTCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCT
GCCCGCCGAGCCGCCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGAC
CTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGGCTCGCCGAAGGCC
TGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGTTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGC
TGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGATGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGTC
GCCGAACGGGTCGGCTCGGCCCAGGGCCTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGAGCCCTTGGCGCCGGGCGCCGAAGCGGCCACCGG
CGAGCAGGGGGGCGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGTGCCAGCGGCGAGATCGCC
AACCGCGAAGACGTCCTGCGCCAGCTCGATCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGCC
CGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCT
CATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA