SecReT6
Protein ID: 478476287
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00435
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]100346..100834 [+]
Producthypothetical protein
NoteTssD
UniProt IDM9RTY8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|478476287|ref|YP_007706938.1| hypothetical protein G655_00435 [Pseudomonas aeruginosa B136-33]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLM
MACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQK
ADGAKDGGPVKYGWNIRQNVQA
 
Nucleotide Sequence: 489 bp     [Download]
>gi|478476202|ref|NC_020912.1|:100346-100834 Pseudomonas aeruginosa B136-33, complete genome
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGG
AAATCGACGTGCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGG
CGCCGGCAAGGTCAACGTGCAGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATG
ATGGCCTGCTCCAGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACC
AGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGTGG
CGAGGATCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAG
GCGGATGGCGCGAAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTGCAGGCCTGA