SecReT6
Protein ID: 478476288
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00440
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]101062..101847 [+]
Productputative secretion protein
NoteTagJ
UniProt IDM9RV45
KEGG IDpsg:G655_00440
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.40E-43, Aligned region: 139..256
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 2..54
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 112..130
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 6..62
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 111..131
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 2..39
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 36..53
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 93..121
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 3..51
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 102..119
Protein Sequence: 261 a.a.     [Download]
>gi|478476288|ref|YP_007706939.1| putative secretion protein [Pseudomonas aeruginosa B136-33]
MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTY
STAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAP
FAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVALLPARYAE
TVEHGDDAARLGRKTEWLDSGLPVGQRLFATDAGETALFDLRELDFEPTDA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|478476202|ref|NC_020912.1|:101062-101847 Pseudomonas aeruginosa B136-33, complete genome
ATGATCGCCGAAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGC
GCAGCCAGCCGTCGAACGCTACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGC
GCGGGCGCAGAACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTAC
TCCACCGCCATCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCG
GCCAGCCGGCGGAATGGATCGCGCCGCTGTTGCAGGCCCTGAGCCTGGACGCCGAAGGCCATGGCGAGGC
CGCCCAGGCCCTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGGCGGATCGGCGAAGCGCCG
TTCGCCTGGCTGGCGGATGCCGACACGCGCCTCGGCCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATG
CCTGGTTGCCGATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGACCTGGTCTG
GCTGCCGGCCGAACTGACCCTGGCCAACGGTGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAA
ACCGTCGAGCACGGCGACGACGCCGCGCGCCTGGGGCGCAAGACCGAATGGCTGGACAGCGGCCTGCCGG
TCGGCCAGCGGCTGTTCGCCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAACTGGACTTCGA
GCCGACGGACGCCTGA