SecReT6
Protein ID: 478476290
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00450
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]102355..104214 [+]
Producttype VI secretion protein TssF
NoteTssF
UniProt IDM9S0J1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-224, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|478476290|ref|YP_007706941.1| type VI secretion protein TssF [Pseudomonas aeruginosa B136-33]
MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGALSSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWP
LEVAQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLG
NACAVFVRAPDNAWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRAL
RRCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFE
VHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSKQRRKGPRSTYVGSETFVALVD
ANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLAERGQGAAALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEIT
LDFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|478476202|ref|NC_020912.1|:102355-104214 Pseudomonas aeruginosa B136-33, complete genome
ATGAACCCGCGCCTGCTCGAGTACTACAACCAGGAATTGCAACACATCCGCGAAAGCGCCGCGGAGTTCG
CCGAGGAATTCCCGAAGATCGCCGGGCGCCTGTCGCTGTCCGGCTTCGAGTGCGCCGACCCCTACGTCGA
GCGCCTGCTGGAAGGCTTCGCCTATCTCACCGCGCGGGTCCAGCTGAAGCTCGACGCGGAGTACCCGACC
TTCACCCACAACCTGTTGGAAATCGCCTACCCGCACTACCTGGCGCCGACCCCGTCGATGACCGTGGTGC
AGTTGCGCCCGGACCCCAACGAAGGCGCCCTGAGCAGCGGCTTCAGCGTCGAGCGCGGGGCCTCCCTGCG
CGGCCAGCTCGGCCCCGATGACCAGACCGCCTGCGAATACCGCACCGCCCACCCGGTGACCCTGTGGCCG
CTGGAAGTGGCCCAGGCCGACTACTTCGGCAATCCCGCCGCGGTGCTCGGCCGCCTCGCCGCCAGCGAGC
CGCGGGCCAAGGCCGGCCTGCGCATCCGCCTGCGCAGCGGCGCCGGCATCCCGTTCGACAGCCTGTCGCT
GGACGCCCTGCCGCTCTACCTGCACGGCGCCGACGAACAACCCTACCGCCTCTACGAACAATTGCTCGGC
AACGCCTGCGCGGTGTTCGTCCGCGCCCCGGACAATGCCTGGGTCGAACGCCTGCCGACGAGCAGCCTGC
GTGCGCGCGGCTTCGACGACGAGGACGCGCTGCTGCCGGTGGTGCCGCGGGCGTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCGGCGCGCTTCCTGTTCGTCGAGTTCTCCGGCCTGAACCGCGCCCTG
CGTCGATGCCACGGCGAGGAGCTGGAACTGGTCGTGCTGTTCGGCAAGCATGACCAGCGCCTGGAGGGCA
CGGTGGACGCGGAGCAACTGGTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGCGCCGCTGCGACCG
CATCCACCTGTCCGACCGGGTCAACGAGCATCACGTGATCGTCGACCGCACCCGTCCGCTGGATTTCGAG
GTGCATTCGCTGCAACAGGTGAGCGGCCACGGCAGCGGTCCGGAGCAACCCTTCCAACCGTTCTACGCGG
TGCGCGACCCGGCGCGCTACGGCCGCGAGCAGGCCTACTTCAGCGTGCGCCGCGAACCGCGCGTGCTGTC
CAGCAAGCAGCGGCGCAAGGGCCCGCGCTCGACCTACGTCGGCAGCGAGACCTTCGTCGCCCTGGTCGAC
GCCAACCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGCATCGCCGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGCCGATCGGCGCGCACAAGAGCGACTTCACCCTGGAGGACAGCGCGCCGGTCATGCA
GGTGCGCTGCCTCGCCGGACCGAGCCGGCCGCGCGCCAGCCGTGCCCACGATGCCAGCGCCTGGCGGCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGCTGGCCGAGCGCGGCCAGGGCGCCGCCGCCCTGCGCGAGC
TGCTGCGGCTCTACGGCGACAGCGGCGATCCGGCGTTGCAATTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAGCCTTGCACGCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGTGGCCTGGAGATCACC
CTGGACTTCGACGAGAACGCGTTCCGCGGCACCGGGGTGTTCCTCCTCGGCGCCGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGCTGCGCACCGGCGAACGGGGCGAGGTGAT
GAGATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGA