SecReT6
Protein ID: 478476298
SecReT6 ID746
T6SS typei3
Gene symbol-
Locus tagG655_00490
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]112624..114849 [+]
Producthypothetical protein
NoteTssI
UniProt IDM9RV50
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-89, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 2.80E-89, Aligned region: 346..394
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 529..552
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 586..608
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 594..616
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 715..731
Phage_base_V [PF04717], Evalue: 7.80E-26, Aligned region: 369..462
Protein Sequence: 741 a.a.     [Download]
>gi|478476298|ref|YP_007706949.1| hypothetical protein G655_00490 [Pseudomonas aeruginosa B136-33]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETIS
IGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASI
RMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|478476202|ref|NC_020912.1|:112624-114849 Pseudomonas aeruginosa B136-33, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGC
AGCGAATGGAGGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCC
CGACCTGCCACTCGACGGGCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGG
CGGCATTTCCACGGCATCGTCGCCGCTTGCAGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCACCAGAGCCCACCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGC
GACCATTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGCTCGCACGCGGCGGCCGACTACCC
GCTGTACGACTACCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGGACCCGTATCGAA
GCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCCGCGCCCGCGGCCTGGGTTCGGGCCACCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGTGAGTACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCGCAGTTCGAGAGCGAGCTGGACTGCATC
GATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCACTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCCCAGGCCTGGGCGGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATAACCATCGGCGTCGACCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGTATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCG
GCGTCGACCGCACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGTGCCAATCGCACCGAGGACGT
CGGCAACGACGAGACCATCAGCATCGGCGCGAACCGTAGCGAGTCGGTGGGCAACAACGAGACGATCAGC
ATCGGCGCCGACCGCAGCGAGTCGGTGGGCGCCAACGAGACCATCGACATAGGCGGCAACCAGAGCACCA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCGCGATACCTCGGTGGGCAAGGACGATAGCCT
GGACGTGGGCAAGAGCTTCACGCTCAACGCCGGCGACTCGATCACCCTGGTCACCGGTGCCGCCAGCATC
CGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGATCCGGGGCGATCA
ACGTCAAGGCCGACAAGAACGTGGTGGTGAAGGGACGCAAGATCCTCCAGAACTGA