SecReT6
Protein ID: 478478828
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13180
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2892536..2894542 [-]
Producthypothetical protein
NoteTssI
UniProt IDM9S285
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-72, Aligned region: 31..322
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 6.20E-15, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 6.20E-15, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 6.20E-15, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 6.20E-15, Aligned region: 650..661
Protein Sequence: 668 a.a.     [Download]
>gi|478478828|ref|YP_007709479.1| hypothetical protein G655_13180 [Pseudomonas aeruginosa B136-33]
MPRPTDSNTSLSLTASALAALFPERLAGEERLNALPGWELLGYSASPLALDGAIATHLTATLHNDADQRP
LDGLVAEIRQLPGDASAERYQVLLRPWLWWLTLASNNRVFQNLATSDIVTQVFDQHGFSDYQLQLSGSYQ
PREYCVQYGESDLAFVSRLLEEDGIFWFFTHAAGKHTLVLADSNDAFPPIPNGPQVAYLGQGIGVRELQG
VRSAQYSLQAVSGTYSATDYEFTTPSTSLYSQAEAVSGAAGVYQHPGGYTAKAQGDSLTKQRIDGLRSQE
TRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRM
HTQTALVVGKAGEEIWTDQYGRIKIQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVN
VLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGG
NYSHKVSGNFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKAGTEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c2894542-2892536 Pseudomonas aeruginosa B136-33, complete genome
ATGCCCCGTCCCACCGATAGCAATACCAGCCTCTCCCTGACCGCCTCGGCGCTGGCAGCCCTGTTCCCGG
AGCGTCTGGCCGGGGAAGAACGCCTGAACGCACTGCCCGGTTGGGAACTGCTGGGCTACAGCGCCAGCCC
CTTAGCCCTGGACGGCGCAATCGCCACCCATCTCACCGCCACCCTGCACAACGACGCCGACCAGCGTCCG
CTCGACGGCCTGGTCGCGGAGATCCGCCAACTCCCCGGCGATGCCAGCGCCGAGCGCTACCAGGTGCTGT
TGCGCCCCTGGCTCTGGTGGCTGACGCTGGCCAGCAACAACCGGGTGTTCCAGAACCTCGCCACCAGCGA
CATCGTCACCCAGGTCTTCGACCAGCACGGCTTCAGCGACTACCAGTTGCAGCTCAGCGGCAGCTACCAG
CCCCGCGAATACTGCGTGCAGTACGGCGAGAGCGACCTCGCCTTCGTCTCGCGGCTGCTGGAGGAAGACG
GCATCTTCTGGTTCTTCACCCATGCCGCCGGCAAGCACACCCTGGTGCTGGCCGACAGCAACGACGCCTT
CCCGCCGATTCCCAACGGCCCGCAAGTGGCCTACCTGGGCCAAGGAATCGGCGTGCGCGAGTTGCAGGGC
GTGCGTTCGGCGCAGTACAGCCTCCAGGCGGTATCCGGGACCTACAGCGCCACCGACTACGAGTTCACCA
CCCCGAGCACCTCGCTGTACTCCCAGGCCGAGGCGGTTTCCGGCGCCGCCGGCGTCTACCAGCACCCCGG
CGGCTACACCGCCAAGGCCCAGGGCGACAGCCTGACCAAGCAACGCATCGACGGCCTGCGCAGCCAGGAG
ACGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATG
ACGACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCG
CAATCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCCCCGCGCGGGTCACGCCCAAGCCGCGCATG
CACACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCCTCCTGCTGGGTGCGCGTGGTGCT
GCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGACAACCAGACGCAGTCCGGGATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGACGCCGAGGAAGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAAC
GTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAG
CGACAGTCTGGATGTGAAGGACACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACAAGGTCAGCGGCAACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCG
GCACCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCCGG
CACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCC
GGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCACCGAACAGACGGTGGACG
GCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTAAAGGTCAACTGA