SecReT6
Protein ID: 478478833
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13205
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2899823..2901616 [-]
Producttype VI secretion protein VasA
NoteTssF
UniProt IDM9S288
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-181, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|478478833|ref|YP_007709484.1| type VI secretion protein VasA [Pseudomonas aeruginosa B136-33]
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGNLAEGYRLPRDTALFVTTRGGDSVHFRSSAEATL
WPLAIDEATLLGGEEAQALTGVGAARSALRLSLRCLGEYRWDELSIERLRIHLAASPMGCAILYDLLAAH
AVQVMAGAPGTPPAALRGLPEIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADGQ
TLYLYLVFDRAPTARLHLQAEDFQLGCAPAINIFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAV
RSVAGSTVQPVPAYYGCRHDSQLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLREAPAFSLTAELL
CTNRYLAERLGAGTALGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSLVEGPRALEAL
REILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGASGVLFSAVLA
QFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c2901616-2899823 Pseudomonas aeruginosa B136-33, complete genome
ATGAGCGATTCGATTGATGCCGACCTGCTCGACTACTACCAGCGCGAGCTGACCTGGCTGCGGCATGCCG
GCGGCGCCTTCGCCGAGCGCTATCCGAAGGTCGCCCGGCGCCTGCAACTGGCCCCCGGCGAATGCCCCGA
CCCGCACGTCGAGCGTCTGCTGGAAGGCTTCTCGCTGCTCACCGCGCGCCTGCAACGGCGCCTCGACGAC
GACTACGCAGAGTTCAGCGACGCCCTCCTCGAACAGCTCTACCCCCTGGCGCTGCGCCCGCTGCCGTCCT
GCGCGATCGTCCAGTTCGAACCGGACCCGACCCAGGGCAACCTCGCCGAGGGCTACCGGCTGCCGCGCGA
CACCGCGCTGTTCGTCACCACCCGTGGCGGCGACAGCGTGCATTTCCGCAGCAGCGCCGAGGCGACTTTG
TGGCCGCTGGCGATCGACGAGGCGACCCTGCTCGGCGGCGAGGAGGCGCAAGCCCTGACCGGAGTCGGCG
CCGCCCGCTCGGCGTTGCGCCTGAGCCTGCGCTGCCTGGGCGAGTACCGCTGGGACGAACTGTCGATCGA
GCGCCTGCGCATCCACCTGGCGGCTTCGCCGATGGGCTGCGCGATCCTCTACGACCTGCTCGCCGCGCAT
GCCGTGCAGGTCATGGCGGGGGCGCCCGGCACGCCGCCGGCGGCGCTCCGCGGACTGCCGGAGATCGTCG
GCTTCGCCGCCGACGAGGCGCTGCTGCCGGAGGAAGACGGCGGACATCCGGGCCTGCGCCTGCTCGCCGA
GTACTTCGCCTTCCCCGACAAGTTCCACTTCTTCGACCTGCCGCTGTCCGGCGCGCTCGCCGACGGACAG
ACGCTCTACCTGTACCTGGTCTTCGATCGCGCACCGACGGCACGCCTGCATTTGCAGGCGGAAGACTTCC
AGCTCGGCTGCGCGCCGGCGATCAACATCTTTCCGCGGACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAGTACCGCCTGGTCGCCGACAGTCACCGCGAGAACAGCGTGGAAATCCATAGCATCCGCGCCGTG
CGCTCGGTTGCCGGGAGCACCGTGCAGCCAGTCCCGGCCTACTATGGCTGCCGCCACGACAGCCAACTAG
GCACGCTCTACTGGCACGCCCGGCGCATCGCCGGGCTGACCCCGAACCGGCTGGGCAGCGACCTGCTGCT
GAGCCTGGTGGATACCGGCTTCGACCCGTTGCGCGAGGCCCCGGCCTTCAGCCTGACCGCCGAGCTGCTA
TGCACCAATCGCTATCTGGCCGAGCGCCTGGGTGCCGGCACCGCGCTGGGCTTCGAACGGCCCGGGCCGG
TCGCCGCCGCACGCCTGCGCAACGCGCCCAGCGCGCAGAGCCAGCCGCGCCTGGACGGCCAGTCGCGCTG
GAGACTGGTCTCGCAGCTGACCCTCAACCACCTGTCGCTGGTGGAAGGCCCGCGCGCCCTCGAAGCCCTG
CGGGAAATCCTCGCCCTGCACAACCTGCGCGACGATGCCAGCGCCCGCCGGCAGATAGAAGGCCTGCGGC
AACTCGACTGCCAGCGGGTGGTGGCGCACGTCGGCGAGGATGCCTGGCGCGGCTGGCGCAATGGCCTGGA
GATCCGCCTGCGACTCGATCCGCAACACTTCGTCGGCGCCAGCGGCGTGCTGTTCTCCGCCGTGCTGGCG
CAGTTCTTCTCGCTGTATGCCACCGCCAACCGCTTCGTGCGCACGGTCCTGGTGGAAGCCGACAAGGAGG
TGAAGACATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGA