SecReT6
Protein ID: 478478834
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13210
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2901600..2902025 [-]
Producthypothetical protein
NoteTssE
UniProt IDM9RZL6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|478478834|ref|YP_007709485.1| hypothetical protein G655_13210 [Pseudomonas aeruginosa B136-33]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPAHARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGRLRSGSRLMPALFVIEQGNDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c2902025-2901600 Pseudomonas aeruginosa B136-33, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGCATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCACGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGTGGCCGCCTGCGCAGCGGGTC
GCGCCTGATGCCTGCGCTATTCGTCATCGAACAGGGCAACGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA