SecReT6
Protein ID: 478478835
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13215
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2902038..2902535 [-]
Producthypothetical protein
NoteTssD
UniProt IDM9S7V6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|478478835|ref|YP_007709486.1| hypothetical protein G655_13215 [Pseudomonas aeruginosa B136-33]
MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTL
NEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAASTWDLAANQLVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c2902535-2902038 Pseudomonas aeruginosa B136-33, complete genome
ATGGATGCGATCATTCTCGATTTCGGCAGCGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACA
AGATCGAAATCATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCAAACCCCACGTCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCGACCCTC
AACGAATACTGCTGCGCCGGCAAGCCGATCGCCGAGGCGACCATCACCATCGGCCGCAACGCCGCCGAGG
GCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTGGAGACCCTGTCGCTGAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACCAGCTGG
TCAAGTGA