SecReT6
Protein ID: 478478839
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13235
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2905444..2906736 [+]
Producthypothetical protein
NoteTssK
UniProt IDM9RZM1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-69, Aligned region: 7..398
Protein Sequence: 430 a.a.     [Download]
>gi|478478839|ref|YP_007709490.1| hypothetical protein G655_13235 [Pseudomonas aeruginosa B136-33]
MQLLPQHFQLQGLRAEALAARTGQACNPWFWGVTALELDPSALCAGQVRVLHLEAILPDGLPVSVQAGVD
APLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEHPEPITVWRASLRL
VGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLVLPESPLGRRVQSLCARAREKALFLGGRLRLAQQA
GNQDDAVEVRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGVPAFEALDFLDLRR
GYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGEQAAADWLERAIVA
SDPHLPLLARQRMSGLARQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVAPVSGVASSPWQIV
LFVADGSDNT
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|478476202|ref|NC_020912.1|:2905444-2906736 Pseudomonas aeruginosa B136-33, complete genome
ATGCAACTGCTTCCCCAGCATTTCCAGTTGCAGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCACCGGAC
AGGCCTGCAACCCTTGGTTCTGGGGCGTGACCGCCCTGGAACTGGACCCCTCGGCGTTGTGCGCCGGCCA
AGTGCGGGTCCTGCACCTCGAAGCGATCCTGCCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGAC
GCGCCGCTGGAGTTCGACCTGGAGACAGCGCTGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGG
CGGTCAGTCCGCTGTGGCGGGCGGGTCAGTTGCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGC
GCCGCTGCCGGACCTGGCCAGCGGCGAGCACCCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTG
GTCGGCGACGACGGCAAGGCCGACTCCGTGTGCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCT
ATGTCAGCCTGCCCTACGTCCCGCCGACGCCATTGGTGCTGCCGGAGTCGCCCCTGGGCAGGCGCGTGCA
GTCGCTCTGCGCGCGGGCCCGGGAGAAGGCGCTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCG
GGTAACCAGGACGACGCCGTGGAAGTCCGTCGCCAGCTCGCCGCGCTCTGGACCCGCCTGCCGGAGGTGG
AAGGCCTGCTGGCAAGCCGCGCGGCCTCGCCGCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGGGC
CTGGGCGGCGCTCGATCCGCTGGCCGGCGTGCCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGT
GGCTACGAGCCGCTGCTGGACTGGCTGGAGCGCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGC
CGTTCGAGCAGGAGGAACAGGTATTTTCCGTGCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGT
CGGTCTGCGGATGCCCGCCGGCGCCGGCGAACAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCC
TCCGACCCGCACCTGCCGTTGCTCGCCCGGCAACGCATGAGCGGGCTGGCGCGGCAGCCGATGAATCGCC
AGGAACAGGTGGCCTACAGCGTTGGCGACGATACCCGTTTGTTCGTCGTGCAGGGCGCCGGCGACTGGTT
CGATGCCGGCCAGCCGCTGCGCATCGTCGCGCCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTG
CTGTTCGTCGCCGACGGCAGCGACAACACCTAA