SecReT6
Protein ID: 478478840
SecReT6 ID747
T6SS typei4a
Gene symbol-
Locus tagG655_13240
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2906754..2907512 [+]
Producttype VI secretion protein DotU
NoteTssL
UniProt IDM9S7W0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.70E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|478478840|ref|YP_007709491.1| type VI secretion protein DotU [Pseudomonas aeruginosa B136-33]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQEKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|478476202|ref|NC_020912.1|:2906754-2907512 Pseudomonas aeruginosa B136-33, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAGCCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGCGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACTCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGAAAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGCTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGCCGCCTGGAGCAGCCCGCCGCCGCGCCGCCACGGCGCCTGCCGGTGCGCGCGGCGCTGCCGGACGGT
TTCCGCCTGGGCCTGGCGGTGCTCGGCCTGGTGCTGCTGATGAGCGGCATCGGGCACCTGTTCTGGCGCG
ACATCCAGCATGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA