SecReT6
Protein ID: 479192291
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1240
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1282634..1284340 [-]
ProductRHS domain protein
NoteTssI
UniProt IDI7IC66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-68, Aligned region: 23..378
Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 85..116
Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 418..508
Protein Sequence: 568 a.a.     [Download]
>gi|479192291|ref|YP_007822187.1| RHS domain protein [Taylorella asinigenitalis 14/45]
MAERMAIAKAAVEDLKFLNLKGKEGISQIYEFEVEMVSKDPNIDVRKMLGTNLTVEVETTTEGGSSEANE
IANNPVVGSMKKMMKLAEEKAGEAAEVASIPRKVMEAAIGSVGSPQKPRYFSGRVRRFEMEGPAHDHSEY
YIYKATVVAPLWFLNQGKDYKIFQEKSVKDIVKEILDKFNVDHEFKLSGNYRDWGFVVQYNESCFNFISR
LMEHEGMYYWFKHEDGSVKMIIADDLSASETFPQYENLNYVSGPSQVGDTRELISSWRHTAQVTPSKYTV
IDFDFRKPKTSLDTNTDNKLDGDDDIEVYEWQGGYQELADGDCYAKLRLEEFKTPQEYIEADTNARGVCP
GYKFKLANHPRNSENIECLVLNAKYEISVHDYASGSVSQDNFETSFECLPTSIQFRAPRKTPEPKTTGPQ
TATVVGPEDGKPYTEKHGRVKVHFHWDRDGKKDGEDSCWVRVSSPWASTGYGSLQIPRVGDEVIVDFIGG
SPDRPIIVGRVYNEDNKNLVDMTSEAHTTGFRTRTIDGGSDNQNFLLFTDKKGEELVDIQAEKDMKQFIK
NDLFITVG
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1284340-1282634 Taylorella asinigenitalis 14/45 draft genome
ATGGCAGAACGTATGGCGATCGCTAAGGCAGCAGTTGAAGATTTAAAATTTCTTAACTTAAAAGGTAAAG
AAGGCATTTCGCAAATTTATGAATTTGAAGTAGAAATGGTTTCTAAGGATCCTAATATTGATGTTCGTAA
AATGTTAGGAACTAATTTGACTGTAGAAGTTGAAACTACTACGGAGGGCGGTAGCTCTGAGGCTAATGAG
ATAGCTAACAATCCAGTAGTCGGATCAATGAAAAAAATGATGAAACTTGCTGAAGAGAAGGCAGGTGAAG
CTGCGGAAGTTGCTAGTATTCCTAGAAAAGTTATGGAAGCGGCTATTGGAAGTGTGGGTAGTCCGCAAAA
ACCTAGGTATTTTTCTGGTCGCGTAAGACGTTTTGAAATGGAAGGACCTGCACACGATCATTCAGAATAT
TACATTTATAAAGCTACTGTTGTAGCTCCTCTGTGGTTTTTAAATCAAGGTAAAGATTACAAAATCTTCC
AAGAAAAATCTGTAAAAGATATTGTTAAAGAGATATTAGATAAATTCAATGTTGATCATGAATTCAAATT
ATCAGGTAATTATCGTGATTGGGGTTTTGTAGTTCAATATAACGAATCATGCTTTAATTTTATTTCTCGT
TTGATGGAACATGAAGGTATGTACTACTGGTTCAAGCATGAAGACGGTAGCGTTAAGATGATTATCGCAG
ACGACCTATCAGCTAGCGAAACTTTCCCCCAATATGAAAATCTTAATTACGTTTCAGGTCCATCTCAAGT
TGGAGACACTCGTGAGTTGATTTCTTCATGGAGGCATACAGCACAAGTAACTCCATCAAAATATACTGTC
ATTGATTTTGACTTCCGTAAACCAAAAACATCTCTTGACACTAATACTGATAACAAACTTGACGGGGATG
ATGATATTGAAGTTTACGAATGGCAGGGCGGTTATCAAGAATTAGCTGATGGTGATTGTTACGCTAAACT
AAGACTTGAAGAGTTCAAAACTCCACAAGAATATATTGAAGCTGATACTAATGCTCGCGGTGTGTGCCCT
GGCTACAAATTTAAATTAGCTAATCATCCACGTAATTCAGAAAATATTGAATGTTTAGTTTTAAATGCTA
AATATGAAATTTCTGTACATGATTATGCTTCTGGATCTGTTTCTCAAGATAATTTTGAAACTTCATTTGA
GTGTTTACCTACATCAATTCAATTCAGAGCTCCTCGTAAAACACCAGAACCGAAAACTACGGGACCTCAA
ACTGCTACTGTGGTAGGCCCAGAGGATGGTAAACCTTACACTGAGAAACATGGTCGAGTTAAGGTTCATT
TCCACTGGGATCGTGACGGTAAGAAAGATGGTGAAGATTCATGCTGGGTTCGTGTTTCCAGTCCTTGGGC
TTCAACAGGTTACGGTAGTCTTCAAATTCCACGTGTAGGCGATGAAGTTATTGTAGATTTTATCGGCGGT
TCGCCTGATAGACCTATCATAGTTGGACGTGTCTACAATGAAGATAATAAAAACTTAGTTGATATGACCA
GTGAAGCTCATACAACTGGTTTCCGTACTAGAACTATTGATGGTGGCAGTGATAATCAAAACTTCTTGTT
ATTCACCGATAAGAAAGGTGAGGAACTTGTAGACATACAAGCTGAAAAAGATATGAAACAATTCATCAAA
AATGATTTGTTCATTACAGTTGGTTAG