SecReT6
Protein ID: 479192295
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1244
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1289023..1290918 [-]
Producthypothetical protein
NoteTssF
UniProt IDI7JNE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-194, Aligned region: 6..630
Protein Sequence: 631 a.a.     [Download]
>gi|479192295|ref|YP_007822191.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MENDFIEYYNRELAYIREMGREFAEQYPKVASRLGMEGIQVADPYVERLMEGFSFLTARIHKKMDAEFPQ
FTQNLLEVLYPHYISPTPAIGIIDFDINSKKGDLVKGYTLPKGTVFRARTGGKECRFSTGHEITFHPVEI
EEAEISSSMSDLPPKLLKNFRGSKQIRSALRIQIKVVGGSTISDLKNFDKLTFFLNGEEIYTHKLLEMLM
AHTIGIVAHDHERPIRWTKFIDVKNLKHEGFEANQSLLPSDSRVFQGYRQLHEYFAFPQRYLFTSLTGVE
KAIALPEDLKKQKIKAFELTFLFDKAAHELEGVITAENLRLHSVPVINLFPMQANRINVTPNAHEFHVVV
DRAKPLDYEIYSIDQVTVNAPGQKEVQEFRPFFDIYGANGDSINQFYSLRREVRKPSLNQSQVAKRTGYR
GSEVFISIVDVGNPPYNEQEVFGLNIETTCTNRDLPHIFSSGGDVDFRFNVSVPVDKVHFIKNPSRPRAP
LGREAYSWRLINHLNLNYLNLLDSDEESGAEAVRELLHIYSDLGDPLLARQIQGIRSIKLDPIYRRMPVK
GAIVFGRGVSIKVLLDENEFAGISPYLFGAVLEQFFARHVSINMLTELELSTLQSGIIATWKPRLGGRPT
V
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1290918-1289023 Taylorella asinigenitalis 14/45 draft genome
ATGGAAAACGATTTTATCGAGTACTATAATCGCGAACTAGCTTACATACGTGAGATGGGGCGTGAGTTCG
CAGAACAGTACCCTAAAGTTGCTAGCCGTTTGGGTATGGAAGGTATACAAGTTGCCGATCCATATGTTGA
ACGCCTTATGGAAGGCTTTAGCTTTCTTACAGCTCGTATTCATAAAAAAATGGATGCTGAGTTTCCTCAG
TTTACGCAAAATCTACTAGAAGTTTTATATCCACACTATATTTCGCCAACACCTGCTATAGGTATTATCG
ACTTTGATATAAATTCTAAGAAAGGTGATTTGGTTAAGGGATATACACTACCTAAAGGTACAGTTTTTAG
AGCCCGTACTGGTGGCAAAGAATGTCGGTTCTCCACTGGACACGAGATAACCTTTCACCCTGTTGAAATT
GAAGAGGCAGAGATTTCATCATCTATGAGCGATTTGCCTCCAAAATTGCTTAAGAATTTTAGAGGCAGTA
AGCAGATTCGCTCTGCCCTTAGAATTCAGATTAAAGTAGTTGGTGGAAGTACGATTTCGGACCTTAAGAA
TTTTGATAAACTCACATTCTTTTTAAATGGTGAGGAAATCTATACCCACAAACTCCTTGAGATGCTCATG
GCACATACTATTGGTATAGTTGCACATGACCATGAAAGACCTATTAGATGGACTAAATTTATCGATGTAA
AAAATTTAAAACATGAAGGATTTGAAGCAAATCAGTCATTATTGCCATCAGACAGTAGGGTATTCCAAGG
ATATAGACAGTTACATGAATATTTTGCGTTTCCACAAAGGTATTTGTTTACAAGTTTAACTGGAGTGGAG
AAAGCGATAGCATTGCCAGAGGACCTTAAGAAACAAAAAATTAAGGCATTTGAACTTACGTTTTTATTCG
ATAAAGCTGCTCATGAACTCGAGGGTGTGATTACAGCCGAGAATTTGCGTTTGCATAGTGTGCCTGTTAT
CAATTTATTTCCTATGCAAGCAAATAGAATTAATGTGACTCCAAATGCTCATGAGTTTCACGTTGTAGTA
GACCGTGCGAAGCCTCTGGACTACGAAATTTACTCGATAGATCAAGTTACCGTTAATGCTCCAGGCCAAA
AAGAAGTTCAAGAATTTAGGCCCTTTTTTGATATATATGGGGCAAATGGAGATTCTATAAATCAGTTTTA
TTCTTTGCGACGCGAAGTTAGGAAGCCTTCTTTAAATCAAAGTCAGGTAGCTAAGAGAACTGGCTATCGA
GGAAGTGAAGTATTTATTTCAATCGTAGATGTAGGTAATCCCCCGTATAATGAGCAAGAGGTGTTTGGAT
TAAATATAGAGACTACATGTACAAATAGAGATTTGCCACATATATTCAGTAGTGGTGGGGATGTTGATTT
TAGGTTCAATGTGTCGGTCCCTGTAGATAAAGTTCACTTTATTAAGAACCCATCTCGACCACGTGCACCG
CTTGGACGTGAGGCCTATTCGTGGCGTCTGATTAATCATTTAAACCTTAACTACTTAAATCTACTGGACT
CGGATGAGGAATCAGGTGCAGAAGCTGTTCGTGAGCTTTTGCATATTTATTCTGATCTTGGGGATCCTTT
ATTGGCTAGGCAGATACAGGGAATTCGTAGCATTAAACTTGATCCTATTTATAGACGTATGCCAGTGAAA
GGTGCTATTGTTTTCGGTAGAGGCGTTAGTATTAAAGTGCTTTTAGACGAAAATGAATTTGCAGGGATTA
GTCCATATTTGTTTGGAGCAGTGCTAGAGCAGTTTTTCGCAAGGCACGTATCAATTAATATGCTTACAGA
GTTAGAGCTATCGACCTTGCAATCCGGAATCATTGCCACATGGAAACCTAGACTAGGTGGACGGCCCACA
GTCTAA