SecReT6
Protein ID: 479192296
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1245
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1290918..1291481 [-]
Productlysozyme-like protein
NoteTssE
UniProt IDI7IC67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-17, Aligned region: 54..163
Protein Sequence: 187 a.a.     [Download]
>gi|479192296|ref|YP_007822192.1| lysozyme-like protein [Taylorella asinigenitalis 14/45]
MVTAHQKRKIEGLSKRSHQDYKDKLQPVLLDKLTDEHPERRKELRETATVINYEQLKKSVLRDLSWLLNT
VNLESIESLDGYDHVKSSTINFGVFPVAGQKMSEINQFEIQQQVKSAIIYFEPRILPNDLDVICELEESD
LEHYNVLSLIIKGRLWCNPHPMEFFLRTSVDLESGHMEIKDEGRGSV
 
Nucleotide Sequence: 564 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1291481-1290918 Taylorella asinigenitalis 14/45 draft genome
ATGGTTACAGCTCATCAAAAAAGAAAAATAGAGGGCTTATCTAAAAGAAGTCATCAAGACTATAAAGATA
AACTTCAGCCCGTTTTGCTTGATAAGCTTACAGACGAGCATCCAGAACGTAGAAAAGAACTTCGTGAAAC
TGCTACGGTTATTAATTACGAGCAGTTAAAAAAATCGGTTCTTAGAGATTTGAGTTGGCTGCTTAATACA
GTTAATCTTGAGTCTATTGAGTCTCTTGATGGTTATGATCATGTTAAAAGCTCGACCATTAATTTTGGAG
TATTTCCTGTGGCTGGTCAAAAGATGTCTGAAATTAACCAGTTTGAGATTCAACAGCAAGTTAAGTCGGC
CATAATTTATTTTGAACCTAGAATACTTCCTAACGACCTTGATGTTATCTGTGAATTGGAAGAGTCTGAC
CTAGAACACTACAATGTATTGTCACTTATAATCAAAGGTAGACTTTGGTGTAACCCTCATCCTATGGAAT
TTTTCTTACGTACATCCGTAGATTTAGAGTCTGGACATATGGAAATTAAGGATGAAGGTAGGGGATCTGT
ATAA