SecReT6
Protein ID: 479192298
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1247
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1292418..1292903 [-]
Producthypothetical protein
NoteTssD
UniProt IDI7J2D7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-35, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|479192298|ref|YP_007822194.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MAVDMFLKISSVEGESKDSKHAKWTDIESFAWGATQPGSMATGGGGGTGKASFNDLHVICRIDRAAPTVM
KHCATGKHLDKVEVSVNKAGGEQVEYSRITLEDVLVTSVQYTGEKDGDAMMVSYSFQGAKVKQQYWEQSE
KGTKGAESVVGYDIKQNKATA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1292903-1292418 Taylorella asinigenitalis 14/45 draft genome
ATGGCTGTTGATATGTTCTTGAAAATTTCTAGCGTAGAAGGTGAATCTAAAGATTCTAAACATGCAAAAT
GGACTGACATCGAATCATTCGCTTGGGGTGCTACTCAACCTGGTTCTATGGCTACTGGCGGTGGCGGCGG
TACTGGTAAAGCTAGCTTCAACGACCTTCATGTTATTTGCCGCATCGACCGTGCTGCACCTACAGTAATG
AAACATTGTGCTACTGGTAAACACTTAGACAAAGTTGAAGTTTCTGTAAACAAAGCAGGTGGCGAACAAG
TTGAATACTCTAGAATCACTTTAGAAGACGTTCTTGTTACTTCAGTTCAATACACTGGCGAAAAAGATGG
CGACGCTATGATGGTTAGCTACTCTTTCCAAGGTGCTAAAGTTAAACAACAATACTGGGAGCAATCAGAA
AAAGGTACTAAAGGTGCTGAATCTGTTGTTGGTTACGACATCAAACAAAATAAAGCTACTGCTTAA