SecReT6
Protein ID: 479192299
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1248
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1292972..1294465 [-]
Producthypothetical protein
NoteTssC
UniProt IDI7ILF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-197, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|479192299|ref|YP_007822195.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MATEALKQGQEKGTLEVEGLSSLLKKEFKPKTEEAQSAVESAVKTLAEQALSSAVTISSDSYITIQNIIA
EIDRKLSQQINVILHNEEFQKLEGAWRGLHYLVSNTETDELLKIRFMPITKKELGRTLKRHKGTAWDQSP
IFKRIYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEMAKIAAAAHCPFISGADPSLMQMDSWQELSN
PRDISKIFTNTEYAAWRSLRETDDARYLGLTLPRFLARLPYGARTNPVDEFDFEEDTEGANHNNYTWANS
AYAMATNINRSFKEYGWCTSIRGVESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPAEYDDPDATANARLAARLPYLFACCRFAHYLKCIVRDKVGSFTSRNEME
DWLNTWIMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKKGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1294465-1292972 Taylorella asinigenitalis 14/45 draft genome
ATGGCTACTGAAGCTTTAAAACAAGGTCAAGAGAAAGGTACTCTAGAGGTTGAAGGTTTATCTTCACTTC
TTAAAAAAGAATTTAAACCTAAGACTGAAGAAGCACAAAGTGCAGTTGAAAGTGCCGTTAAAACTCTTGC
AGAGCAAGCACTTTCTTCAGCTGTTACCATCTCTTCAGATTCATATATCACTATTCAAAATATTATTGCT
GAGATTGATCGTAAATTATCTCAACAGATTAACGTAATTCTTCATAATGAAGAGTTCCAAAAATTAGAAG
GTGCGTGGCGTGGTCTTCACTACTTAGTGTCTAACACAGAAACAGATGAATTATTAAAAATCCGTTTCAT
GCCTATCACTAAAAAAGAGCTTGGCCGTACACTTAAACGTCATAAAGGTACAGCTTGGGATCAAAGCCCT
ATTTTCAAACGTATTTATGAAGAAGAATACGGTCAATTCGGTGGTGAACCAATTGGTTGTATCGTAGGTG
ACTATCATTTTGATCATAGTCCTCCTGATGTTGAATTGCTTGGTGAGATGGCTAAGATTGCTGCCGCAGC
TCACTGCCCATTTATCTCTGGTGCAGACCCATCATTAATGCAGATGGATTCTTGGCAGGAACTTTCTAAC
CCACGTGATATAAGCAAAATCTTTACAAATACTGAGTATGCTGCTTGGAGAAGTTTGCGTGAAACTGATG
ACGCACGTTACTTAGGTTTAACTTTACCTCGTTTCCTAGCTCGTCTGCCATACGGTGCTCGTACAAACCC
AGTAGATGAGTTTGATTTTGAAGAAGATACTGAGGGAGCTAACCACAACAATTACACTTGGGCTAACTCT
GCATATGCAATGGCTACAAATATTAACCGTTCATTCAAAGAGTATGGTTGGTGTACATCTATCCGTGGTG
TAGAATCAGGAGGTGCTGTAGAAGGCTTACCTACTCATACATTCCCAACAGATGATGGCGGCGTTGATAT
GAAATGCCCTACTGAAATTGCTATCAGTGACCGTCGTGAAGCCGAACTAGCTAAAAATGGATTTATGCCA
CTAGTTCACCGTAAGAATTCAGACTTTGCTGCATTTATTGGAGCTCAGTCATTACAAAAACCAGCTGAAT
ATGATGACCCAGATGCTACAGCAAATGCTCGTCTAGCAGCTCGTTTACCTTATTTATTTGCATGCTGCCG
TTTCGCTCACTACTTAAAATGTATTGTCCGCGATAAAGTGGGTTCATTTACATCACGTAATGAGATGGAA
GATTGGTTAAATACTTGGATTATGAATTATGTTGATGGAGATCCAGCTAACTCATCTCAAGAAACTAAAG
CACGTAAACCACTTGCAGCTGCTGAAGTGCAAGTTGCGGAAATCGAAGATAATCCTGGCTATTATGCAGC
TAAATTCTTCTTGCGTCCGCATTATCAGTTAGAGGGTTTAACCGTTTCATTAAGGTTAGTCTCTAAATTG
CCATCTCTTAAAAAGGGTGGCTAA